KEGG   Streptococcus equi subsp. equi 4047: SEQ_1611Help
Entry
SEQ_1611          CDS       T00877                                 

Definition
beta-galactosidase precursor
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SEQ_1611
Enzymes [BR:seu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SEQ_1611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1617116..1618915)
Genome map
AA seq 599 aa AA seqDB search
MERFQISDQFYLDGRSLQILSGAIHYFRIHPDDWYHSLYNLKALGFNTVETYVPWNLHEA
REESYDFSGQLDVEAFLTLAQQLGLYAIVRPSPYICAEWEFGGLPAWLLTKNCHIRSSDP
VYLAYVRRYYEELLPRLARHEWQQGGNILMFQLENEYGSYGEDKAYLTAVKGFMEEHLSA
PLFTADGPWRATLRAGSLIEDDVFVTGNFGSRAQENFADMQAFFSEHGKHWPLMCMEFWD
GWFNRWHEPIIKRDPEERADAVMEVLAQGSINLYMFHGGTNFGFMNGCSARKQLDLPQVT
SYDYDAILDEAGNPTAKFYAIQKRLTAELSEIEVTPPLIKPLMSLPLIGLKDKVSLFSTL
EHISSCQTACYPSNIEALGQSTGYILYRTHLLKDKREDERLRLIDSRDRAQVFLDGQKVA
TQYQETIGDDIIINQQHALSQVDVLIENMGRVNYGHKLTAPSQSKGLGRGMMADLHFVTN
WEMYCLPLDDLSQLCFDGDFYEGQPGFYHYQFECHEPEASYIDMTGFGKGCVFINNHPIG
RFWEVGPLLTLYIPKGYFNKGLNDIVIFETEGVYQDSIRLVDRPISIDYPQADDRTDQT
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
ttggaacgttttcagatttcagatcagttttatttagatggtagatcgctgcaaatcctg
tcaggggctatccattattttagaattcacccagatgattggtatcattcgctttataat
ttaaaggcactgggatttaatacggttgagacctatgtcccttggaatttacatgaggct
agggaggaaagctatgatttctctggccaattagatgtggaagcctttttgacgctggcg
cagcaattggggctctatgctattgtcagacctagtccttatatttgtgcagaatgggaa
tttggtggcctacctgcttggctgctgacaaagaattgtcatatcaggtcgtctgatcct
gtctatttagcctatgtgaggcgctattatgaggagctgctgccgagactagcaaggcat
gaatggcagcagggcggcaatattttgatgtttcagcttgaaaatgaatatggctcctat
ggagaggataaggcctatttaacagctgttaagggctttatggaggagcacctcagtgcg
cccttgtttacagcagatggtccttggcgagccactcttagagctggtagtctgattgaa
gatgatgtctttgtgactggcaactttggctcaagggcacaggagaattttgctgacatg
caggccttcttttctgagcatggcaagcattggcctttaatgtgtatggaattttgggac
ggctggttcaatcgttggcatgagcccatcatcaaacgcgaccctgaagagcgagctgac
gcagtgatggaggttttggcgcagggcagtattaacctgtatatgtttcatgggggaaca
aactttgggtttatgaatggctgctctgccagaaagcaattggaccttccgcaggtgacc
tcctatgattatgacgctatcctagatgaggctggcaatccgacagctaagttttacgcg
attcaaaagcgtctgaccgcggagctttcagagatagaggttactcctcccttgattaag
cccttgatgtcactgcctctgattggtctgaaggacaaggttagtctgtttagcacgctg
gagcacatcagcagctgtcagactgcttgctatcctagtaacatagaggctttagggcaa
tcaacgggctatatcctgtatcggacacatcttttgaaggataagcgtgaggacgagcgt
ttacgcttgattgatagtagagatagagcacaggtctttttagatggtcaaaaggttgca
acacagtatcaggagacgattggtgatgatatcatcattaaccagcagcatgccttgagt
caggtcgatgttttaattgaaaatatgggccgggtcaattatgggcacaagctgacagca
cctagtcaaagtaagggtctaggacgtggtatgatggctgacttgcactttgtgaccaat
tgggagatgtattgtctgccgcttgatgatttgtctcagctttgttttgatggcgatttt
tacgaggggcagcccggcttttatcattatcaatttgaatgtcatgagcctgaggcaagc
tatattgatatgactggctttgggaagggttgtgtctttatcaacaatcaccctattggt
cgtttttgggaagtgggtcccttattaaccctttatattccaaagggctatttcaacaag
ggattaaatgacattgttatttttgaaacagaaggtgtttaccaggatagtatccgtctt
gttgataggccaattagtatagattatccgcaagctgatgacaggactgatcagacctag

DBGET integrated database retrieval system