KEGG   Streptococcus equi subsp. equi 4047: SEQ_1611Help
Entry
SEQ_1611          CDS       T00877                                 

Definition
beta-galactosidase precursor
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:seu00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1617116..1618915)
Genome map
AA seq 599 aa AA seqDB search
MERFQISDQFYLDGRSLQILSGAIHYFRIHPDDWYHSLYNLKALGFNTVETYVPWNLHEA
REESYDFSGQLDVEAFLTLAQQLGLYAIVRPSPYICAEWEFGGLPAWLLTKNCHIRSSDP
VYLAYVRRYYEELLPRLARHEWQQGGNILMFQLENEYGSYGEDKAYLTAVKGFMEEHLSA
PLFTADGPWRATLRAGSLIEDDVFVTGNFGSRAQENFADMQAFFSEHGKHWPLMCMEFWD
GWFNRWHEPIIKRDPEERADAVMEVLAQGSINLYMFHGGTNFGFMNGCSARKQLDLPQVT
SYDYDAILDEAGNPTAKFYAIQKRLTAELSEIEVTPPLIKPLMSLPLIGLKDKVSLFSTL
EHISSCQTACYPSNIEALGQSTGYILYRTHLLKDKREDERLRLIDSRDRAQVFLDGQKVA
TQYQETIGDDIIINQQHALSQVDVLIENMGRVNYGHKLTAPSQSKGLGRGMMADLHFVTN
WEMYCLPLDDLSQLCFDGDFYEGQPGFYHYQFECHEPEASYIDMTGFGKGCVFINNHPIG
RFWEVGPLLTLYIPKGYFNKGLNDIVIFETEGVYQDSIRLVDRPISIDYPQADDRTDQT
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
ttggaacgttttcagatttcagatcagttttatttagatggtagatcgctgcaaatcctg
tcaggggctatccattattttagaattcacccagatgattggtatcattcgctttataat
ttaaaggcactgggatttaatacggttgagacctatgtcccttggaatttacatgaggct
agggaggaaagctatgatttctctggccaattagatgtggaagcctttttgacgctggcg
cagcaattggggctctatgctattgtcagacctagtccttatatttgtgcagaatgggaa
tttggtggcctacctgcttggctgctgacaaagaattgtcatatcaggtcgtctgatcct
gtctatttagcctatgtgaggcgctattatgaggagctgctgccgagactagcaaggcat
gaatggcagcagggcggcaatattttgatgtttcagcttgaaaatgaatatggctcctat
ggagaggataaggcctatttaacagctgttaagggctttatggaggagcacctcagtgcg
cccttgtttacagcagatggtccttggcgagccactcttagagctggtagtctgattgaa
gatgatgtctttgtgactggcaactttggctcaagggcacaggagaattttgctgacatg
caggccttcttttctgagcatggcaagcattggcctttaatgtgtatggaattttgggac
ggctggttcaatcgttggcatgagcccatcatcaaacgcgaccctgaagagcgagctgac
gcagtgatggaggttttggcgcagggcagtattaacctgtatatgtttcatgggggaaca
aactttgggtttatgaatggctgctctgccagaaagcaattggaccttccgcaggtgacc
tcctatgattatgacgctatcctagatgaggctggcaatccgacagctaagttttacgcg
attcaaaagcgtctgaccgcggagctttcagagatagaggttactcctcccttgattaag
cccttgatgtcactgcctctgattggtctgaaggacaaggttagtctgtttagcacgctg
gagcacatcagcagctgtcagactgcttgctatcctagtaacatagaggctttagggcaa
tcaacgggctatatcctgtatcggacacatcttttgaaggataagcgtgaggacgagcgt
ttacgcttgattgatagtagagatagagcacaggtctttttagatggtcaaaaggttgca
acacagtatcaggagacgattggtgatgatatcatcattaaccagcagcatgccttgagt
caggtcgatgttttaattgaaaatatgggccgggtcaattatgggcacaagctgacagca
cctagtcaaagtaagggtctaggacgtggtatgatggctgacttgcactttgtgaccaat
tgggagatgtattgtctgccgcttgatgatttgtctcagctttgttttgatggcgatttt
tacgaggggcagcccggcttttatcattatcaatttgaatgtcatgagcctgaggcaagc
tatattgatatgactggctttgggaagggttgtgtctttatcaacaatcaccctattggt
cgtttttgggaagtgggtcccttattaaccctttatattccaaagggctatttcaacaag
ggattaaatgacattgttatttttgaaacagaaggtgtttaccaggatagtatccgtctt
gttgataggccaattagtatagattatccgcaagctgatgacaggactgatcagacctag

DBGET integrated database retrieval system