KEGG   Streptococcus equi subsp. equi 4047: SEQ_2102Help
Entry
SEQ_2102          CDS       T00877                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
seu  Streptococcus equi subsp. equi 4047
Pathway
seu00010  Glycolysis / Gluconeogenesis
seu00260  Glycine, serine and threonine metabolism
seu00680  Methane metabolism
seu01100  Metabolic pathways
seu01110  Biosynthesis of secondary metabolites
seu01120  Microbial metabolism in diverse environments
seu01130  Biosynthesis of antibiotics
seu01200  Carbon metabolism
seu01230  Biosynthesis of amino acids
Module
seu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
seu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:seu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SEQ_2102
  Energy metabolism
   00680 Methane metabolism
    SEQ_2102
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SEQ_2102
Enzymes [BR:seu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SEQ_2102
Membrane trafficking [BR:seu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SEQ_2102
Exosome [BR:seu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SEQ_2102
  Exosomal proteins of melanoma cells
   SEQ_2102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 CbiC
Motif
Other DBs
NCBI-ProteinID: CAW95437
UniProt: C0MAD3
Position
complement(2117142..2117720)
Genome map
AA seq 192 aa AA seqDB search
MPKVDTITQVYFIRHAEPNYQNHNDVTRELSEHGVKASQDLVRQLAEVSIDAFYSSPYKR
SIDTIAPLAASRAMEIKLIDDLRERKLADAWIEDFVDTAKKQWDDFTFKLPTGESLQEVQ
DRNIAALNRILKEAKGKTVVIGTHGTALSTLINYYQPDFGFEDFDRYKHVFPWIVRASFD
GDKLLGLNEFLV
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaggttgacacgataacgcaggtttattttatccgccacgcagagcctaactat
caaaaccacaacgacgtgactagagagctctccgagcatggggttaaggcgagccaagac
ctggttaggcaactagcagaggtgtcgattgacgccttttattccagtccctataaacgc
tctattgacaccattgccccactagcagctagtagggcaatggaaattaagctgattgac
gatttgagagagcgtaagctagctgatgcttggatagaagactttgtcgacacagccaaa
aagcagtgggacgattttacctttaaattgccgacaggcgaaagcctgcaagaggtacaa
gacagaaatatagcagctcttaaccgtattttaaaagaagcaaaaggcaagacagtagtc
attggcacacatggcacagcactgtcaacccttatcaactactatcaaccagactttggt
tttgaggatttcgaccgatataagcatgtctttccttggatagtcagagctagctttgat
ggtgacaagctgcttgggcttaatgagtttctagtctga

DBGET integrated database retrieval system