KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_01291Help
Entry
STMMW_01291       CDS       T01715                                 

Definition
Meso-diaminopimelate-adding enzyme
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sev00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    STMMW_01291
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    STMMW_01291
Enzymes [BR:sev01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     STMMW_01291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
143480..144967
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDLLAPWVAGLPARELREMTLDSRVAAAGDLFVAVVGHQADGRRYIPQAIAQGV
AAIIAEAKDEASDGEIREMHGVPVVYLSQLNERLSALAGRFYHEPSENMRLVAVTGTNGK
TTTTQLLAQWSQLLGETSAVMGTVGNGLLGKVIPTENTTGSAVDVQHVLASLVAQGATFG
AMEVSSHGLVQHRVAALKFAASVFTNLSRDHLDYHGDMAHYEAAKWMLYSTHHHGQAIVN
ADDEVGRRWLASLPDAVAVSMEGHINPNCHGRWLKAEAVEYHDRGATIRFASSWGEGEIE
SRLMGAFNVSNLLLALATLLALGYPLTDLLKTAARLQPVCGRMEVFTAPGKPTVVVDYAH
TPDALEKALQAARLHCAGKLWCVFGCGGDRDKGKRPLMGAIAEEFADIVVVTDDNPRTEE
PRAIINDILAGMLDAGQVRVMEGRAEAVTNAIMQAKDNDVVLIAGKGHEDYQIVGTQRLD
YSDRVTAARLLGVIA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgaccttcttgctccgtgggtggctggactacccgcgcga
gaactgcgagagatgacgctcgacagccgtgtggctgcggcgggcgatctctttgtggca
gtggtgggtcatcaggcggacgggcgtcgatatatcccgcaggcgatagcgcaaggcgta
gctgccattattgcagaggcgaaagacgaggcgagcgacggtgagattcgcgaaatgcac
ggcgtaccagtcgtctatctcagccagctcaatgagcgtttatctgcgctggcgggccgc
ttttaccatgagccatctgaaaacatgcgtctggtggcggtgaccggcaccaatggcaag
accaccaccacccaactactggcgcagtggagccagttgctcggcgaaaccagcgcagtg
atgggaacggtaggcaacggactgttgggtaaagtgatcccgacggagaacacaaccggt
tccgctgtggatgttcagcatgtgctggccagtctggttgcgcagggcgcgaccttcggc
gcgatggaagtctcttctcacggcctggtgcagcatcgcgtggcggcgttgaaatttgcc
gcctccgtgtttactaatttgagccgcgaccatctcgactatcatggcgatatggcgcat
tacgaggcggcaaaatggatgctttattccacccaccatcatggtcaggcaatcgtcaac
gccgatgatgaagttggacgccgctggctggcgtcgctacccgatgcggtcgcggtatca
atggaagggcatatcaaccctaactgtcacggtcgttggctgaaagcggaggcggtggag
taccacgaccgcggagcgacgattcgttttgcttcaagctggggtgaaggcgaaatcgaa
agccgcttgatgggcgcgtttaacgtcagcaacttactgctggcattggcgacgctactg
gcgctgggctatccgttaacggatttgctgaaaactgccgcgcgtttgcagccggtttgc
gggcgtatggaagtgttcactgcgccaggcaaaccgacggtggtggtggattacgcgcac
acgccggatgcgctggaaaaagcgttgcaggcggcgcgtctgcattgcgccggaaaattg
tggtgcgtctttggctgtggcggggatcgtgacaaaggtaagcgcccactcatgggggcc
attgccgaagaattcgcggatatcgtcgtggtgactgacgataacccgcgtaccgaggag
ccgcgcgccattatcaacgatattctggccggaatgctggacgccgggcaggtcagggta
atggaaggccgcgctgaggcggtaaccaatgccattatgcaggcaaaagacaatgacgtc
gtgctgattgcaggtaaagggcacgaggattaccagattgtcggcacgcagcgtcttgat
tattcagaccgcgtgaccgcagcgcgtttgctgggggtgatcgcatga

DBGET integrated database retrieval system