KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_01591Help
Entry
STMMW_01591       CDS       T01715                                 

Definition
dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sev00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STMMW_01591
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STMMW_01591
   00020 Citrate cycle (TCA cycle)
    STMMW_01591
   00620 Pyruvate metabolism
    STMMW_01591
Enzymes [BR:sev01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     STMMW_01591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
178920..180809
Genome map
AA seq 629 aa AA seqDB search
MAIEIKVPDIGTDEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKVS
VGDKTETGALIMIFDSAEGAADAAPAKAEEKKEAAPAAAPAAAAAKDVHVPDIGSDEVEV
TEVMVKVGDTVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVNTGDKVSTGSLIMVFEVA
GEAGAAAPAKAEAAPAAAAPAAATGVKDVNVPDIGGDEVEVTEVMVKVGDKVTAEQSLIT
VEGDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIMVFEVEGAAPAAAPAKQEAAAPAPA
AKAEKPAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDV
QAYVKDAIKRAEAAPAAAGGGIPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLSRNWV
MIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKYTPVVFIMKAVAAALEQMPRFNSSL
SEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSVTELSRELTTISKKARDGKLTAG
EMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMMPISLSF
DHRVIDGADGARFITIINNMLSDIRRLVM
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcgggacagatgaagttgaaatcaccgagatt
ctggtcaaagtgggcgacaaagtggaagctgaacagtcgctgatcaccgtagaaggcgac
aaagcctctatggaagtcccgtctccgcaggctggcgtcgtgaaagagatcaaagtctct
gtcggcgacaaaaccgagaccggtgcacttatcatgattttcgattccgccgaaggtgca
gccgacgctgcacctgctaaggcagaagagaagaaagaagcggcgccggcagcagcacct
gctgcggcagcggcgaaagacgttcacgttccggatatcggcagtgacgaagttgaagtg
actgaagtgatggtgaaagtgggcgacaccgtagaagctgaacagtcgctgatcaccgtc
gaaggcgacaaggcctctatggaagttcctgctccgtttgcaggcaccgtgaaagagatc
aaagtgaacaccggtgataaagtctctaccggctctctgattatggtcttcgaagtggcg
ggtgaagcaggcgcagcagcaccagcgaaagcggaagccgctccggctgcggctgctcca
gcagcagcgacgggcgtgaaagacgttaacgtaccggacatcggcggcgacgaagttgaa
gtcaccgaagtgatggtcaaagtcggcgataaagttaccgctgaacagtcgctgatcacc
gtagaaggcgacaaagcctctatggaagttccggctccgttcgcgggtaccgtgaaagaa
atcaagatcagcaccggcgataaagtgaaaaccggttctctgattatggtcttcgaagta
gaaggcgcagcgcctgcggccgctccggctaaacaggaagcggcggcgccggctccggcg
gcgaaagctgagaagcctgctgccccggctgcaaaagcggaaggcaaatctgagttcgct
gaaaacgacgcgtacgttcacgctactccgctgattcgccgtctggcgcgcgagtttggc
gtcaacctggcgaaagtgaaaggcaccggtcgtaaaggccgtattctgcgcgaagacgtt
caggcttacgtgaaagacgctatcaaacgcgcggaagctgcgccggctgctgcgggcggc
ggtatcccgggtatgctgccgtggccgaaagtggacttcagcaagtttggtgaagttgaa
gaagtggaactgggccgtatccagaaaatctctggcgcgaacctgagccgtaactgggtg
atgatcccgcacgttacgcacttcgacaaaaccgatatcaccgatctggaagcgttccgt
aaacagcagaacgccgaagctgagaagcgcaaactggatgtgaaatacacgccagtggtc
ttcatcatgaaagcggttgccgctgctctggaacagatgccgcgcttcaacagctctctg
tccgaagacggtcagcgtctgaccctgaagaaatacatcaacatcggcgtggcggttgat
accccgaatggcctggtggttccggtctttaaagacgtgaataagaagagcgtgaccgag
ctgtctcgtgaactgaccaccatctccaaaaaagcgcgtgatggtaagctgaccgctggc
gaaatgcagggtggttgcttcactatctccagcatcggcggcctgggaactacccacttc
gcgccgattgttaacgcgccggaagtggctatcctcggcgtttctaagtcggcgatggaa
ccggtgtggaatgggaaagagtttgtgccgcgtctgatgatgcctatctctctttccttc
gaccaccgtgtgatcgatggtgctgatggtgcgcgtttcattaccattatcaacaatatg
ttgtctgacattcgccgtctggtgatgtaa

DBGET integrated database retrieval system