KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_01891Help
Entry
STMMW_01891       CDS       T01715                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sev00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    STMMW_01891
Enzymes [BR:sev01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     STMMW_01891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(213391..213870)
Genome map
AA seq 159 aa AA seqDB search
MTIAYIALGSNLASPLEQVNAALKAIADIPDSRIVAVSSFYRTPPLGPQDQPDYLNAAVA
LDTALAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGDEVINTDRLTVPHYDMK
NRGFMLWPLFEIAPDLIFPDGISLHQHLTHLGAAKPAHW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgcgtatatcgcgcttggcagtaatctggcctctccgctggagcaggtcaat
gccgccctgaaggctatcgccgacattcccgatagccgtatcgtcgcggtttcttcgttt
taccgcacgccgccgcttggcccacaggatcagcccgattacctgaacgctgcggtggcg
ctggataccgctctcgcccccgaagaattgcttaaccatacccagcgcattgagctgcaa
cagggccgggtgcgcaaagccgaacgctgggggccgcgcacgctggatctcgacattatg
ctgtttggcgatgaagtcattaacaccgaccgtctgaccgtgccgcactacgacatgaaa
aaccgcggttttatgctgtggccgttattcgaaatcgctcctgatctgatctttccggat
ggtatcagcctgcatcagcatctcacccatcttggtgctgcaaaacccgcccactggtaa

DBGET integrated database retrieval system