KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_03321Help
Entry
STMMW_03321       CDS       T01715                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sev00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    STMMW_03321
  Amino acid metabolism
   00330 Arginine and proline metabolism
    STMMW_03321
Enzymes [BR:sev01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     STMMW_03321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
366286..367389
Genome map
AA seq 367 aa AA seqDB search
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQMLLTRADMEDRERFLNARDT
LRALLDNHIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQQGLFTADPR
SNPQAELIKDVYGVDDALRSIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIASGSKPG
VIGDVMEGISVGTRFHAQASPLENRKRWIFGAPPAGEITVDEGATAAMLERGSSLLPKGI
KSVTGNFSRGEVIRICNLQGRDIAHGVSRYNSDALRRIAGHHSQQIDAILGYEYGPVAVH
RDDMITR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagccagacgctggtcgtaaaactcggcaccagcgtgctaacaggcggatcg
cgccgcctgaaccgtgcccatatcgtagaacttgtccgccagtgcgcgcagttacacgcc
gcgggacatcgtattgttattgttacctctggcgcgattgccgccggacgtgaacatctc
ggctacccggaactgccggcaacaattgcctctaaacagcttctggcggcggtagggcaa
agccgcttgattcaactgtgggagcagttgttttcaatttacggtatccatatcgggcag
atgctgttgacgcgtgcggatatggaagacagagagcgctttctgaacgcccgagatacg
ctacgtgcattactggataaccatattgtgccggttatcaatgaaaatgatgccgttgcg
acagcggaaattaaagtgggcgacaacgataacctctccgcgctggcggcgatcctggca
ggcgcggataaactgctgctgctgaccgatcagcaaggattatttaccgccgatccgcgt
agcaatccgcaggcggagcttatcaaagatgtgtatggcgttgacgatgcgctgcgctct
atcgcgggagacagcgtttccgggctgggaaccggtggtatgagcactaagcttcaggcg
gcagacgtggcctgtcgcgcgggtattgatacgattattgcctcaggcagtaaaccgggc
gtgatcggcgatgtgatggaggggatttccgtcggcacccgttttcatgcgcaagcctcg
ccgctggaaaaccgcaaacgttggatcttcggcgcgccgccggcaggtgaaattacggtt
gatgaaggcgcgaccgcggcaatgctggaacgtggcagttcacttctgccaaaaggcatc
aaaagcgtgacgggcaatttctcgcggggggaggtcatcagaatttgtaacctgcaaggg
cgtgatattgctcatggcgtcagccgttataacagtgatgctctgcggcggatagccggt
caccactctcaacaaatcgatgcgattctgggctatgaatatggcccggtcgctgttcat
cgtgatgacatgattactcgataa

DBGET integrated database retrieval system