KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_03721Help
Entry
STMMW_03721       CDS       T01715                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
387178..387681
Genome map
AA seq 167 aa AA seqDB search
MAMSPALRNSVIAAISGGAIAIASVLITGPSGNDGLEGVRYKPYKDVVGVLTVCYGHTGK
DIIPGKTYTEAECKALLNKDLATVARQINPYIKVDIPETTRGALYSFVYNVGAGNFRTST
LLRKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCLWGKQ
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgtcaccggcactacgaaatagcgtaatagcggcgataagtggcggggctatt
gctatagcatctgtgttgatcacaggtccgagtggtaacgatggtctggaaggtgtcaga
tacaaaccatataaggacgtagtaggtgtattaactgtgtgttatggccacactggaaaa
gacattatacccggtaaaacgtataccgaggcagaatgcaaagccctcctgaataaagac
ctcgctactgtcgccagacaaattaacccgtacatcaaagtcgatataccggaaacaacg
cgaggcgccctttactcgttcgtctacaacgtgggcgcaggtaatttcagaacatcgacg
cttcttcgcaaaataaatcagggtgatatcaaaggcgcatgtgatcagctacgtcgctgg
acatacgctggcggtaagcaatggaaagggctgatgactcgccgtgagattgagcgtgaa
gtctgtttgtgggggaagcaatga

DBGET integrated database retrieval system