KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_13001Help
Entry
STMMW_13001       CDS       T01715                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sev00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    STMMW_13001
Enzymes [BR:sev01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     STMMW_13001
    3.5.1.-  
     STMMW_13001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1367627..1368283)
Genome map
AA seq 218 aa AA seqDB search
MTNRALLLVDLQNDFCAGGALAVAEGDSTIDIANALIDWCQPRQIPVLASQDWHPAQHGS
FASQHQAEPYSQGKLDGLPQTLWPDHCVQHTDGAALHPLLNQHAIDACIYKGENPLIDSY
SAFFDNEHRQKTTLDTWLREHDVTELIVMGLATDYCVKFTVLDALELGYAVNVITDGCRG
VNIHPQDSAHAFMEMASAGATLYTLADWEETQGQAVAR
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaccgggccttattactggtcgacttgcaaaatgatttttgcgccggcggcgcg
ctggctgtagcggaaggcgacagcaccatcgacatcgccaacgctcttattgactggtgc
cagccccggcagattccggtgctggccagccaggactggcatcccgcgcagcatggcagc
ttcgccagccagcatcaggcggaaccctatagtcagggaaagctggacgggctgccgcaa
acgctctggccggatcactgcgttcaacataccgacggcgcggcgttacatcccctgctt
aaccaacatgcgattgacgcctgcatctataagggtgaaaacccgctgattgatagctac
agtgcgttttttgacaacgaacatcggcagaaaactacccttgatacctggcttcgcgag
catgacgttaccgagcttatcgtgatggggttggcgaccgattactgcgtaaaatttacg
gtgctggatgcgctagagttgggctatgccgttaacgttatcaccgatggctgtcgcggc
gtgaatattcacccgcaggatagcgcgcacgcgtttatggagatggcgtcggcaggcgcg
acgctgtatacgctggcagactgggaagagacgcagggccaggctgtcgccaggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system