KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_17711Help
Entry
STMMW_17711       CDS       T01715                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:sev00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1869159..1870010
Genome map
AA seq 283 aa AA seqDB search
MMTHWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTLHIEPRHDGEIHLLTPVNGV
ENEDNLIVRAARLLMKVASESGRLPAGSGADISIEKRLPMGGGLGGGSSNAATVLVALNH
LWQCGLSIDELATLGLTLGADVPVFVRGHAAFAEGVGEILTPVNPPEKWYLVAHPGVSIP
TPVIFKDPQLPRNTPKRSIDTLLKCEFSNDCEVIARKRFREVDAALSWLLEYAPSRLTGT
GACVFAEFDTESCARQVLEQAPEWLNAFVAKGVNLSPLHRELL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgatgacccattggccttctccggcaaaattaaatctgtttttatatatcaccggacag
cgagcagacggctaccacacgctgcagacgctgtttcagtttctggattatggcgacaca
ctccacatcgaaccgcgtcacgatggcgaaatccatttattaacgccggttaacggcgtt
gaaaatgaagacaatctgatcgtccgtgccgcgcggctgttgatgaaagtcgcctcggag
agtgggcgcctgcccgccggaagcggtgcggatatcagcattgagaagcgccttcccatg
ggcggcggtctgggcggcggctcatctaacgccgcgaccgttctggtggcgctcaatcat
ctttggcaatgcgggctttccattgatgaactggcgacgctcggcctgacgctcggcgcc
gacgtcccggtctttgttcgtggccacgccgcgtttgccgaaggcgtaggcgaaatatta
acgccggtgaatccgccggaaaaatggtatctggtcgcgcaccctggcgtaagcattccc
acaccggttatctttaaagatcctcaattgccgcgtaatacgccaaaaaggtcaatagat
acgttactaaaatgtgaattcagcaatgattgcgaggttatcgcaagaaaacgttttcgc
gaggttgatgcggcgctttcctggctgttagaatacgcgccgtcgcgcctgactgggaca
ggggcctgtgtctttgctgaattcgatacagagtcttgtgctcgccaggtgcttgagcaa
gccccggaatggctcaatgcttttgtggcgaagggtgtcaacctctccccattgcatcga
gagttactctaa

DBGET integrated database retrieval system