KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_21031Help
Entry
STMMW_21031       CDS       T01715                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sev00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    STMMW_21031
  Amino acid metabolism
   00340 Histidine metabolism
    STMMW_21031
Enzymes [BR:sev01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     STMMW_21031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2174272..2175576
Genome map
AA seq 434 aa AA seqDB search
MSFNTLIDWNSCSPEQQRALLTRPAISASDSITRTVSDILDNVKTRGDDALREYSAKFDK
TEVTALRVTPEEIAAAGARLSDELKQAMTAAVKNIETFHSAQTLPPVDVETQPGVRCQQV
TRPVSSVGLYIPGGSAPLFSTVLMLATPARIAGCQKVVLCSPPPIADEILYAAQLCGVQE
IFNVGGAQAIAALAFGSESVPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPDADIARKVAEAVERQLAELPRADTARQ
ALSASRLIVTKDLAQCVAISNQYGPEHLIIQTRNARDLVDAITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKAGFSALASTIETLAAAERLTAHK
NAVTLRVNALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaataccctgattgactggaacagctgtagccctgaacagcagcgtgcgctg
ctgacgcgtccggcgatttccgcctctgacagtattacccggacggtcagcgatattctg
gataatgtaaaaacgcgcggtgacgatgccctgcgtgaatacagcgctaaatttgataaa
acagaagtgacagcgctacgcgtcacccctgaagagatcgccgccgccggcgcgcgtctg
agcgacgaattaaaacaggcgatgaccgctgccgtcaaaaatattgaaacgttccattcc
gcgcagacgctaccgcctgtagatgtggaaacccagccaggcgtgcgttgccagcaggtt
acgcgtcccgtctcgtctgtcggtctgtatattcccggcggctcggctccgctcttctca
acggtgctgatgctggcgacgccggcgcgcattgcgggatgccagaaggtggttctgtgc
tcgccgccgcccatcgctgatgaaatcctctatgcggcgcaactgtgtggcgtgcaggaa
atctttaacgtcggcggcgcgcaggcgattgccgctctggccttcggcagcgagtccgta
ccgaaagtggataaaatttttggccccggcaacgcctttgtaaccgaagccaaacgtcag
gtcagccagcgtctcgacggcgcggctatcgatatgccagccgggccgtctgaagtactg
gtgatcgcagacagcggcgcaacaccggatttcgtcgcttctgacctgctctcccaggct
gagcacggcccggattcccaggtgatcctgctgacgcctgatgctgacattgcccgcaag
gtggcggaggcggtagaacgtcaactggcggaactgccgcgcgcggacaccgcccggcag
gccctgagcgccagtcgtctgattgtgaccaaagatttagcgcagtgcgtcgccatctct
aatcagtatgggccggaacacttaatcatccagacgcgcaatgcgcgcgatttggtggat
gcgattaccagcgcaggctcggtatttctcggcgactggtcgccggaatccgccggtgat
tacgcttccggaaccaaccatgttttaccgacctatggctatactgctacctgttccagc
cttgggttagcggatttccagaaacggatgaccgttcaggaactgtcgaaagcgggcttt
tccgctctggcatcaaccattgaaacattggcggcggcagaacgtctgaccgcccataaa
aatgccgtgaccctgcgcgtaaacgccctcaaggagcaagcatga

DBGET integrated database retrieval system