KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_21291Help
Entry
STMMW_21291       CDS       T01715                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
sev00040  Pentose and glucuronate interconversions
sev00052  Galactose metabolism
sev00500  Starch and sucrose metabolism
sev00520  Amino sugar and nucleotide sugar metabolism
sev01100  Metabolic pathways
sev01130  Biosynthesis of antibiotics
Module
sev_M00362  Nucleotide sugar biosynthesis, prokaryotes
sev_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sev00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    STMMW_21291
   00052 Galactose metabolism
    STMMW_21291
   00500 Starch and sucrose metabolism
    STMMW_21291
   00520 Amino sugar and nucleotide sugar metabolism
    STMMW_21291
Enzymes [BR:sev01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     STMMW_21291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 EFP_N
Motif
Other DBs
NCBI-ProteinID: CBG25138
Position
complement(2202612..2203505)
Genome map
AA seq 297 aa AA seqDB search
MMNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILCARPV
VGDNPFIVVLPDIIIDDATADPLRYNLAAMVARFNETGRSQVLAKRMKGDLSEYSVIQTK
EPLDNEGKVSRIVEFIEKPDQPQTLDSDLMAVGRYVLSADIWAELERTEPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKSIEQLLHE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatttgaaagcagttataccggtagcgggtttgggtatgcatatgttgcctgcc
accaaggcaatcccaaaagagatgctaccgatcgtcgacaagccaatgattcagtacatt
gtcgatgagattgtggctgcagggatcaaagaaatcgtgctggtgactcacgcgtctaaa
aacgccgttgagaaccacttcgacacctcttatgaacttgaatcacttcttgagcagcgc
gttaagcgtcagcttttggcggaagtgcaatctatctgcccaccgggcgtgacgattatg
aacgttcgccaggcgcagccgttagggctggggcattctattctgtgcgcgcgtccggtc
gtgggcgataaccctttcattgtggtactcccggatattattatcgatgatgctaccgcc
gatccgctgcgctataaccttgcggcgatggtggcgcgtttcaatgaaacgggtcgcagc
caggtgctggcgaagcgcatgaaaggtgatttatcggagtattccgttatccagacgaaa
gaacctctggataatgaaggcaaagtcagccggattgtggagtttatcgaaaaaccggat
cagccgcagacgctggattccgatttgatggcggtaggccgttatgtgctttcagccgac
atctgggcggaactggaaagaaccgaaccgggcgcctggggccgcatccagctcaccgat
gccattgctgaactggcgaaaaaacagtcggttgacgcgatgctaatgacgggtgacagc
tatgactgcggtaaaaaaatgggctacatgcaggcatttgtgaagtacgggctgcgcaac
ctgaaagaaggagccaagttccgtaagagcatagagcagcttttgcatgaataa

DBGET integrated database retrieval system