KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_24101Help
Entry
STMMW_24101       CDS       T01715                                 

Definition
(GenBank) putative fatty acid oxidation complex alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
sev00071  Fatty acid degradation
sev00280  Valine, leucine and isoleucine degradation
sev00281  Geraniol degradation
sev00310  Lysine degradation
sev00362  Benzoate degradation
sev00380  Tryptophan metabolism
sev00410  beta-Alanine metabolism
sev00640  Propanoate metabolism
sev00650  Butanoate metabolism
sev00903  Limonene and pinene degradation
sev00930  Caprolactam degradation
sev01040  Biosynthesis of unsaturated fatty acids
sev01100  Metabolic pathways
sev01110  Biosynthesis of secondary metabolites
sev01120  Microbial metabolism in diverse environments
sev01130  Biosynthesis of antibiotics
sev01200  Carbon metabolism
sev01212  Fatty acid metabolism
Module
sev_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sev00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    STMMW_24101
   00650 Butanoate metabolism
    STMMW_24101
  Lipid metabolism
   00071 Fatty acid degradation
    STMMW_24101
   01040 Biosynthesis of unsaturated fatty acids
    STMMW_24101
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STMMW_24101
   00310 Lysine degradation
    STMMW_24101
   00380 Tryptophan metabolism
    STMMW_24101
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    STMMW_24101
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    STMMW_24101
   00281 Geraniol degradation
    STMMW_24101
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STMMW_24101
   00930 Caprolactam degradation
    STMMW_24101
Enzymes [BR:sev01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     STMMW_24101
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     STMMW_24101
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     STMMW_24101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: CBG25421
Position
complement(2521771..2523918)
Genome map
AA seq 715 aa AA seqDB search
MTTTSAFMLNVRLDNVAVVAIDVPGEKVNTLKAEFATQVRAILKQIRENKALQGVVFISA
KADNFIAGADINMIGHCQNAQEAETLARQGQQLMAEIQALPVPVIAAIHGACLGGGLEMA
LACHRRICTDDVKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALDMILTGKQLRARQAL
KAGLVDDVVPQTILLEAAVELAKKERLAQRTLPVRERILAGPLGRALLFRLVRKKTAQKT
QGNYPATERIIDVIETGLAQGSSSGYDAEARAFGELAMTPQSQALRAIFFASTEVKKDPG
SDAPPGPLNSVGILGGGLMGGGIAWVTACKGGLPVRIKDINTQGINHALKYSWDLLETKV
RRRHIKASERDKQLALISGSTDYRGFSHRDLVIEAVFEDLPLKQQMVAEVEQNCAAHTIF
ASNTSSLPIGDIAANAARPEQVIGLHFFSPVEKMPLVEVIPHASTSAQTIATTVKLAKKQ
GKTPIVVSDKAGFYVNRILAPYINEAIRMLTEGERVEHIDAALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPANVVASILNDDRKGRKNGRGFYLYGEKGRKSKKQVDPA
IYKLIGVQGQSRLSAQQVAERCVMLMLNEAARCFDEKVIRSARDGDIGAVFGIGFPPFLG
GPFRYMDALGPGEMVATLQRLAALYGPRYAPCEQLVRMAERREHFWTNGETDQGN
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgactaccacatcagcttttatgcttaacgtgcgtctggataatgtcgcggttgtcgct
attgatgtccctggagaaaaggtgaacaccctgaaagcggagtttgccacgcaggtacgc
gccatcctgaagcagatccgggaaaataaagcgttgcagggcgttgtttttatctcagcc
aaagcagataactttattgctggcgctgatatcaacatgataggtcactgccaaaacgcg
caggaagcggaaacgctggcgcgtcagggacagcaactgatggcggagatccaggcgttg
cctgttccggttatcgccgccattcacggcgcctgtctggggggcggccttgaaatggcg
ctggcctgccatcggcgcatctgtaccgacgacgttaaaaccgttctcggactgccggag
gtacagttagggcttttaccgggatcgggcggaacgcagcgacttccgcggctggtgggg
gtcagtaccgcgctggatatgatcctgacaggtaaacagcttcgcgccagacaggcgctt
aaagccgggctggttgatgatgtggtgccgcaaactattttactggaagcggctgtcgag
ctggctaaaaaagaacgcctggcgcagcggacattaccggtccgtgaacgtatcctggcg
gggccgctggggcgcgcgctgttatttcgcctggtgcgtaaaaagacagcgcaaaaaacg
cagggtaattatccggcgacggagcggatcattgatgtgattgaaactggactggcgcag
ggcagcagtagcggctatgacgcggaagcgcgcgctttcggcgagctggcgatgacgcct
caatcgcaggcgctgcgcgctattttctttgccagtaccgaggtgaaaaaagatcccggt
agcgatgcgccgcccggcccgctgaacagcgtgggcatcttaggcggcgggttaatgggc
ggcggtatcgcctgggttacggcctgtaaaggcggcttgccagtacgaattaaggatata
aatactcaggggatcaatcatgctctgaagtacagctgggatctgcttgaaacaaaagta
cgccgccgccatatcaaagccagcgaacgcgataaacagttggcgttgatatcaggttcg
accgattaccgtggtttcagtcatcgtgatctggtcattgaagcggtgtttgaagatctg
ccgttaaaacaacagatggtggcggaagtggagcaaaattgcgctgctcacaccattttt
gcctccaatacttcttccctgccgattggcgatattgcggcgaatgcggccagaccggaa
caggtgattggattgcacttttttagcccggtcgaaaaaatgccgctggttgaggttatt
cctcatgcgtctacttccgcgcagaccatcgccacgaccgttaagctggcgaaaaaacag
ggtaaaaccccgatagtcgtcagtgataaagccgggttttatgttaaccgaattcttgcg
ccatatatcaatgaggcgattcggatgctgactgaaggcgaacgcgtcgaacatattgac
gccgccctggtaaaatttggttttccggtggggccaatccaacttttggatgaggtagga
atcgacacgggcactaaaattattcctgtgcttgaggcggcgtatggagaacgttttagc
gcgcctgcaaatgttgtcgcttcaattttgaatgacgatcgcaaaggtagaaaaaatggt
cgcggtttctatctttatggcgaaaaagggcgtaaaagcaaaaaacaggttgaccctgct
atttataagcttattggcgtgcaagggcagagtcgattgtctgcgcagcaggtggcagag
cgctgtgtcatgttaatgcttaacgaagcggcgcgctgtttcgacgaaaaagtgattcgc
agcgcgcgcgatggcgatatcggcgccgtgtttggtatcggttttccgccgtttctcggt
ggcccgttccgctatatggatgctctcgggccgggtgaaatggtggcgacattacagcgc
ctggccgcactttacggtcctcgttacgcgccttgtgaacaattagtgcgcatggcggag
cgcagggagcatttctggacgaatggggaaactgaccagggaaattga

DBGET integrated database retrieval system