KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_28891Help
Entry
STMMW_28891       CDS       T01715                                 

Definition
L-isoaspartyl protein carboxyl methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3060846..3061472)
Genome map
AA seq 208 aa AA seqDB search
MVSGRVQALLEQLRAQGIRDEQVLNALAAVPREKFIDEAFEHKAWENIALPIGQGQTISQ
PYMVARMTELLELTPQSRVLEIGTGSGYQTAILAHLVHHVCSVERIKGLQWQARRRLKQL
DLHNVSTRHGDGWQGWQARAPFDAIIVTAAPPEIPTALMAQLDEGGILVLPVGDEQQFLK
RVRRRGGEFIIDTVEAVRFVPLVKGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtaagtggacgtgtacaggctcttcttgaacaattgcgcgcgcagggcatcagagat
gagcaggtgcttaatgcgcttgctgcagtgccgcgcgagaaatttattgatgaagcgttt
gaacataaggcctgggaaaatatcgctttgccgataggccagggtcagacgatttcgcag
ccctatatggtggcgcgaatgacggagctgctcgaactgacgccgcaatccagggtgctg
gaaattggtaccggttccggctatcagacggcgattctggcgcatctggtacatcacgtt
tgctccgttgagcggattaaggggctgcaatggcaggcgcgtcgccgcctgaagcagctc
gatttacataatgtttctacccgtcatggcgatggctggcaaggctggcaggcgcgtgcg
ccatttgacgctatcattgtgacggccgcgccgccggaaattcctaccgcgctcatggca
cagttggatgaaggcggcattcttgttctgcccgtgggcgatgagcagcagtttttgaaa
cgcgtgcgtcgccggggcggcgaatttattatcgataccgtggaggccgttcgcttcgtc
ccgttagtcaagggagagctggcctag

DBGET integrated database retrieval system