KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_30031Help
Entry
STMMW_30031       CDS       T01715                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Brite
Enzymes [BR:sev01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     STMMW_30031
Secretion system [BR:sev02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   STMMW_30031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
complement(3194947..3195621)
Genome map
AA seq 224 aa AA seqDB search
MFSGVAHADDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMY
DVSGAHPVNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDITCGYCHKLHEEMKDYN
ALGITVRYLAFPRQGLESQAEQDMKSIWCAKDKNKAFDDAMAGKGVKPASCDVNIADHYA
LGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTSGK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtgttttcaggcgtggcccatgcggatgatgcggctatccgtcagtcgctggctaagctg
ggcgttcagagtacggaaattcaggcctcgccagtggcagggatgaaaaccgtcctcact
cacagcggcgtactgtacgtcactgatgacggcaaacatattattcaagggccgatgtat
gacgtgagcggcgcgcatccggtaaacgtgacgaacaaactgctgatgagccagctaaat
gcgctggaaaaagagatgatcgtctataaagcgccggatgagaaacatgtcattactgtt
tttaccgatatcacctgcggctattgtcataagctacatgaagagatgaaagattataac
gcgctggggatcacggtacgttatctggcttttccgcgccaggggctggaaagccaggcg
gagcaggatatgaaatctatctggtgcgccaaagacaaaaacaaagcgtttgatgacgcc
atggcaggtaagggcgtgaaaccggcaagctgtgacgtgaacattgctgatcattatgcg
ttgggcgtgcagttgggcgttagcggtacgccagccattgtattgagtaacggctatgtg
gtgcctggctatcagggaccgaaagagatgaaagcgtttcttgatgagcatcaaaaacag
accagtggtaaataa

DBGET integrated database retrieval system