KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_34211Help
Entry
STMMW_34211       CDS       T01715                                 

Definition
50S ribosomal protein L5
Orthology
K02931  
large subunit ribosomal protein L5
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:sev00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    STMMW_34211
Ribosome [BR:sev03011]
 Ribosomal Proteins
  Mitochondria
   Large subunit
    STMMW_34211
  Bacteria
    STMMW_34211
  Archaea
    STMMW_34211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3613258..3613797)
Genome map
AA seq 179 aa AA seqDB search
MAKLHDYYKDEVVNKLMTEFNYNSVMQVPRVEKITLNMGVGEAIADKKLLDNAAADLTAI
SGQKPLITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFFERLITIAVPRIRDFRGLSAK
SFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTAKSDEEGRALLAAFDFPFRK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaactgcatgattactacaaagacgaagtagttaacaaactcatgactgagttt
aactacaattctgtcatgcaagtccctcgggtcgagaagatcaccctgaacatgggtgtt
ggtgaagcgatcgctgacaagaaactgctggataacgcagcagcagacctgacagcaatc
tccggtcaaaaaccgttgatcaccaaagcacgcaaatctgttgcaggcttcaaaatccgt
cagggctatccgatcggctgtaaagtaactctgcgtggcgaacgcatgtgggagttcttt
gagcgcctgatcactattgctgttcctcgtatccgtgacttccgtggcttgtccgctaag
tcattcgacggtcgtggtaactacagcatgggtgtccgtgagcagatcatcttcccagaa
atcgactacgataaagtcgaccgcgttcgtggtttggatattaccattaccactactgcg
aaatctgacgaagaaggccgtgctctgctggctgcctttgacttcccgttccgcaagtaa

DBGET integrated database retrieval system