KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_34211Help
Entry
STMMW_34211       CDS       T01715                                 

Definition
50S ribosomal protein L5
Orthology
K02931  
large subunit ribosomal protein L5
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
Ribosome
Brite
KEGG Orthology (KO) [BR:sev00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    STMMW_34211
Ribosome [BR:sev03011]
 Ribosomal Proteins
  Mitochondria
   Large subunit
    STMMW_34211
  Bacteria
    STMMW_34211
  Archaea
    STMMW_34211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3613258..3613797)
Genome map
AA seq 179 aa AA seqDB search
MAKLHDYYKDEVVNKLMTEFNYNSVMQVPRVEKITLNMGVGEAIADKKLLDNAAADLTAI
SGQKPLITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFFERLITIAVPRIRDFRGLSAK
SFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTAKSDEEGRALLAAFDFPFRK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaactgcatgattactacaaagacgaagtagttaacaaactcatgactgagttt
aactacaattctgtcatgcaagtccctcgggtcgagaagatcaccctgaacatgggtgtt
ggtgaagcgatcgctgacaagaaactgctggataacgcagcagcagacctgacagcaatc
tccggtcaaaaaccgttgatcaccaaagcacgcaaatctgttgcaggcttcaaaatccgt
cagggctatccgatcggctgtaaagtaactctgcgtggcgaacgcatgtgggagttcttt
gagcgcctgatcactattgctgttcctcgtatccgtgacttccgtggcttgtccgctaag
tcattcgacggtcgtggtaactacagcatgggtgtccgtgagcagatcatcttcccagaa
atcgactacgataaagtcgaccgcgttcgtggtttggatattaccattaccactactgcg
aaatctgacgaagaaggccgtgctctgctggctgcctttgacttcccgttccgcaagtaa

DBGET integrated database retrieval system