KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_39281Help
Entry
STMMW_39281       CDS       T01715                                 

Definition
detergent-resistant phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sev00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    STMMW_39281
   00565 Ether lipid metabolism
    STMMW_39281
   00590 Arachidonic acid metabolism
    STMMW_39281
   00591 Linoleic acid metabolism
    STMMW_39281
   00592 alpha-Linolenic acid metabolism
    STMMW_39281
Enzymes [BR:sev01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     STMMW_39281
    3.1.1.32  phospholipase A1
     STMMW_39281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4184620..4185366
Genome map
AA seq 248 aa AA seqDB search
MLQEHDNPFTLYPYDTNYLIYTNTSDLNKEAISTYNWSENARKDEVKFQLSLAFPLWRGI
LGPNSVLGASYTQKSWWQLSNSKESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYN
HDSNGRSDPTSRSWNRLYTRLMAENGNWLVEVKPWYVIGSTDDNPDITKYMGYYQLKIGY
HLGEAVLSAKGQYNWNTGYGGAEVGLSYPVTKHVRLYTQVYSGYGESLIDYNFNQTRVGV
GVMLNDIF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgctacaggagcatgataacccttttacgctttacccttatgacacgaactacttgatc
tacacgaacaccagcgatctgaacaaagaggccataagtacctacaactggtctgaaaac
gcacgtaaagatgaagtgaaatttcagttgagcctggcgtttccgctgtggcgcggaata
ctggggccgaactcggtactgggcgcttcctatacgcagaaatcctggtggcagctttcc
aacagtaaagagtcttcgccgtttcgcgaaaccaactacgaaccgcagctttttcttggt
tttgctaccgattatcgctttgccggctggacgctgcgcgacgtagagatgggctacaac
catgactctaacggacgttcggaccccacctcgcgtagctggaaccgtctgtatacccgt
ctgatggccgaaaacggtaactggctggtagaggtcaaaccgtggtacgtgattggcagt
accgatgataatccggacatcaccaaatatatgggttattaccagcttaaaatcggttat
cacctgggcgaggcggtattaagcgccaaaggccagtacaactggaatacaggctacggc
ggcgcggaagttggattaagctatccggtcactaaacatgtccggctttatacccaggtg
tacagcggctatggcgaatcgctgatcgactataattttaatcagacacgtgtcggcgtc
ggcgtgatgcttaacgatatcttctga

DBGET integrated database retrieval system