KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_39281Help
Entry
STMMW_39281       CDS       T01715                                 

Definition
detergent-resistant phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:sev00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:sev00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:sev00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:sev00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4184620..4185366
Genome map
AA seq 248 aa AA seqDB search
MLQEHDNPFTLYPYDTNYLIYTNTSDLNKEAISTYNWSENARKDEVKFQLSLAFPLWRGI
LGPNSVLGASYTQKSWWQLSNSKESSPFRETNYEPQLFLGFATDYRFAGWTLRDVEMGYN
HDSNGRSDPTSRSWNRLYTRLMAENGNWLVEVKPWYVIGSTDDNPDITKYMGYYQLKIGY
HLGEAVLSAKGQYNWNTGYGGAEVGLSYPVTKHVRLYTQVYSGYGESLIDYNFNQTRVGV
GVMLNDIF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgctacaggagcatgataacccttttacgctttacccttatgacacgaactacttgatc
tacacgaacaccagcgatctgaacaaagaggccataagtacctacaactggtctgaaaac
gcacgtaaagatgaagtgaaatttcagttgagcctggcgtttccgctgtggcgcggaata
ctggggccgaactcggtactgggcgcttcctatacgcagaaatcctggtggcagctttcc
aacagtaaagagtcttcgccgtttcgcgaaaccaactacgaaccgcagctttttcttggt
tttgctaccgattatcgctttgccggctggacgctgcgcgacgtagagatgggctacaac
catgactctaacggacgttcggaccccacctcgcgtagctggaaccgtctgtatacccgt
ctgatggccgaaaacggtaactggctggtagaggtcaaaccgtggtacgtgattggcagt
accgatgataatccggacatcaccaaatatatgggttattaccagcttaaaatcggttat
cacctgggcgaggcggtattaagcgccaaaggccagtacaactggaatacaggctacggc
ggcgcggaagttggattaagctatccggtcactaaacatgtccggctttatacccaggtg
tacagcggctatggcgaatcgctgatcgactataattttaatcagacacgtgtcggcgtc
ggcgtgatgcttaacgatatcttctga

DBGET integrated database retrieval system