KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_43481Help
Entry
STMMW_43481       CDS       T01715                                 

Definition
cysQ protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:sev00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4663758..4664498
Genome map
AA seq 246 aa AA seqDB search
MLEQVCQLARNAGDAIMQVYDGAKPMEYARKQDDSPVTAADIAAHTVILEGLRTLTPDIP
VLSEEDPPAWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIEQGKPVLGVVYAPVL
KVMYYAAEGKAWKEECGVRKQIQVRDARPPLVVISRSHTDDELTEYLQQLGEHQTTSIGS
SLKFCLVAEGQAQLYPRFGPTSVWDTAAGHAIAVAAGAHVHDWQGKTLDYTPRESFLNPG
FRVTIY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacaagtatgccagcttgcacggaacgcgggcgatgccattatgcaggtttat
gatggagccaaaccgatggagtacgcccgcaagcaggacgattctccagtcactgcggcg
gatatcgccgcacataccgtgattctcgaagggttacgcacgctcacgccggatattccg
gtgctttcagaagaggatccgcccgcctgggaagtgcgccagcactggcagcgttactgg
ctggtcgatccgctcgacggcaccaaggagttcatcaagcgcaatggcgaattcacggtc
aatatcgcgctgattgagcagggcaagccggtgttgggcgtggtctatgcgccggtgctg
aaagtgatgtactacgcggcggaaggtaaggcctggaaagaggagtgcggggtgcgtaag
cagattcaggtccgggatgcccgcccgccgctggtggtgattagccgttcgcatacggat
gatgaactcaccgaatatctccaacagcttggcgaacatcagacaacctctattggttcc
tcgctgaaattctgccttgtggcggaaggccaggcgcagctttaccccagatttgggccg
accagcgtctgggacactgccgcaggtcatgccattgccgttgcagccggggcgcacgtt
cacgactggcagggaaaaacgctggactatacccctcgtgaatcgttccttaaccccggc
ttccgggtgactatttactga

DBGET integrated database retrieval system