KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_44051Help
Entry
STMMW_44051       CDS       T01715                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:sev00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    STMMW_44051
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STMMW_44051
Enzymes [BR:sev01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     STMMW_44051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4725960..4726895)
Genome map
AA seq 311 aa AA seqDB search
MANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSF
ETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFS
GQVPVLNAGDGSNQHPTQTLLDLFTIQETQGRLDNLHIAMVGDLKYGRTVHSLTQALAKF
SGNRFYFIAPDALAMPQYILDMLDEKGMAWSLHGSIEEVMADVDILYMTRVQKERLDPSE
YANVKAQFVLRASDLNGARENMKVLHPLPRIDEITTDVDKTPHAWYFQQAGNGIFARQAL
LALVLNSELSL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctaacccgctatatcaaaaacatatcatttccataaacgacctcagccgcgacgat
cttaatctggtactggcgacggcggcgaaattaaaagccaacccgcagccggagcttttg
aaacataaagtgatcgccagctgctttttcgaagcctccacgcgtacccgcctgtcgttt
gaaacttcaatgcatcgcctgggcgccagcgtagtgggcttctccgacagcgccaacacg
tcgctggggaaaaaaggagaaacgttagccgacacgatctcagtgattagcacttacgtg
gacgcgattgtgatgcgccatccgcaagaaggcgcggcacgtctggcgacggagttttcc
ggtcaggtgccggtgctcaatgcgggcgacggttcgaaccagcatccgacacagaccctg
ttggatctgttcaccatccaggaaacgcagggccgtctggataacttgcatatcgcgatg
gtcggcgatctgaaatatggccgcaccgtgcattcgctaacccaggcgctggcgaaattt
agcggcaaccgtttttattttatcgcgccggacgcgctggcgatgccgcagtacattctg
gatatgctggatgaaaaagggatggcctggagcctgcatggttctattgaagaggtcatg
gccgacgtcgacatcctctatatgactcgcgtacagaaagagcgtctcgacccgtcggag
tacgccaatgtgaaggcgcagtttgttctgcgcgccagcgacctgaacggcgcgcgtgaa
aatatgaaagtgctgcacccgctgccgcggattgatgaaatcaccacggatgtggataaa
acgccacacgcctggtacttccaacaggcgggcaacggtattttcgctcgccaggcgtta
ctggcgttagtactgaatagcgaactgagtctgtaa

DBGET integrated database retrieval system