KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_45001Help
Entry
STMMW_45001       CDS       T01715                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sev00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    STMMW_45001
   00240 Pyrimidine metabolism
    STMMW_45001
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    STMMW_45001
   03430 Mismatch repair
    STMMW_45001
   03440 Homologous recombination
    STMMW_45001
Enzymes [BR:sev01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     STMMW_45001
DNA replication proteins [BR:sev03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     STMMW_45001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4834247..4834684
Genome map
AA seq 145 aa AA seqDB search
MTSRRDWQLQQLGITQWALRRPGALQGEIAISLPAHVRLIVVAEELPALNEPLMRDILRA
LTVSPDQVLPLTPERVAMLPQGSRCNSWRLGTDAPLQLEGAQVTTPAFNELRANPAARAA
LWQQICEHEHDFYPQHDRSPRSLAD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggtattacgcagtgggcgctgcga
cgtcctggcgcgctacagggcgagattgcgatttcccttcccgcgcacgttcgtctgatc
gtggttgcagaggaattacctgcgctgaacgagccgctaatgcgcgatatcttacgcgcg
ttgaccgtgagtcccgatcaggttttaccgctgacgcctgagcgcgtcgccatgctgccg
cagggcagccgttgtaatagctggcggttaggaactgacgcgccgctccaactcgaaggc
gctcaggtcacgacgccggcgtttaatgaactccgggcaaacccggcggcacgcgccgca
ctatggcaacaaatctgcgaacatgaacacgatttctatcctcagcacgaccgatctccc
cgcagcctggcagattga

DBGET integrated database retrieval system