KEGG   Salmonella enterica subsp. enterica serovar Typhimurium D23580: STMMW_45001Help
Entry
STMMW_45001       CDS       T01715                                 

Definition
(GenBank) DNA polymerase III, psi subunit
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
sev  Salmonella enterica subsp. enterica serovar Typhimurium D23580
Pathway
sev00230  Purine metabolism
sev00240  Pyrimidine metabolism
sev01100  Metabolic pathways
sev03030  DNA replication
sev03430  Mismatch repair
sev03440  Homologous recombination
Module
sev_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sev00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    STMMW_45001
   00240 Pyrimidine metabolism
    STMMW_45001
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    STMMW_45001
   03430 Mismatch repair
    STMMW_45001
   03440 Homologous recombination
    STMMW_45001
Enzymes [BR:sev01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     STMMW_45001
DNA replication proteins [BR:sev03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     STMMW_45001
DNA repair and recombination proteins [BR:sev03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     STMMW_45001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi CSTF_C
Motif
Other DBs
NCBI-ProteinID: CBG27509
Position
4834247..4834684
Genome map
AA seq 145 aa AA seqDB search
MTSRRDWQLQQLGITQWALRRPGALQGEIAISLPAHVRLIVVAEELPALNEPLMRDILRA
LTVSPDQVLPLTPERVAMLPQGSRCNSWRLGTDAPLQLEGAQVTTPAFNELRANPAARAA
LWQQICEHEHDFYPQHDRSPRSLAD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggtattacgcagtgggcgctgcga
cgtcctggcgcgctacagggcgagattgcgatttcccttcccgcgcacgttcgtctgatc
gtggttgcagaggaattacctgcgctgaacgagccgctaatgcgcgatatcttacgcgcg
ttgaccgtgagtcccgatcaggttttaccgctgacgcctgagcgcgtcgccatgctgccg
cagggcagccgttgtaatagctggcggttaggaactgacgcgccgctccaactcgaaggc
gctcaggtcacgacgccggcgtttaatgaactccgggcaaacccggcggcacgcgccgca
ctatggcaacaaatctgcgaacatgaacacgatttctatcctcagcacgaccgatctccc
cgcagcctggcagattga

DBGET integrated database retrieval system