KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A0157Help
Entry
SeSA_A0157        CDS       T00743                                 

Gene name
coaE
Definition
dephospho-CoA kinase (EC:2.7.1.24)
Orthology
K00859  
dephospho-CoA kinase [EC:2.7.1.24]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:sew00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(163094..163714)
Genome map
AA seq 206 aa AA seqDB search
MRYTVALTGGIGSGKSTVADTFADLGITVIDADIIARQMVEPGQPALNAIAEHFGSELIA
ADGTLRRRALRERIFSHPEEKAWLNALLHPLIQQETQRQFQQATSPYVLWVVPLLVENRL
YQKANRVLVVDVTPETQLMRTMQRDDVTREHVEHILAAQATREARLAVADDVIDNNGAPD
AIASDVARLHASYLKLASQFVSQEKP
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaggtataccgtagccttaaccggcggtattggcagcggtaaaagtaccgtcgctgat
accttcgctgacctcggaataaccgtcatcgacgcggatattatcgcgcgccagatggtt
gagccagggcagcccgccctgaacgcaatagcggaacattttggttctgaacttatcgcc
gccgacggcacgttacgtcgccgggcgctgcgtgagcgtattttttcgcatccggaagaa
aaagcctggcttaacgctctgcttcatcccttaattcagcaggaaacccaacgacagttt
caacaggctacgtcgccctatgtgttatgggttgtgcctctgctggttgaaaacaggctg
tatcaaaaagccaaccgcgtactggtggttgacgttacgcccgaaacgcagcttatgcgc
acaatgcagcgtgatgatgttacgcgcgagcatgttgaacacattctcgctgcgcaggcg
acgcgtgaagcgcgccttgccgtggcggacgatgttattgataataacggcgcaccggat
gctatcgcatcagatgtggcccgcctgcacgccagttatcttaagctcgcgtcgcagttt
gtctcacaggaaaaaccgtaa

DBGET integrated database retrieval system