KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A0172Help
Entry
SeSA_A0172        CDS       T00743                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
sew00010  Glycolysis / Gluconeogenesis
sew00020  Citrate cycle (TCA cycle)
sew00620  Pyruvate metabolism
sew01100  Metabolic pathways
sew01110  Biosynthesis of secondary metabolites
sew01120  Microbial metabolism in diverse environments
sew01130  Biosynthesis of antibiotics
sew01200  Carbon metabolism
Module
sew_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sew00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeSA_A0172 (aceF)
   00020 Citrate cycle (TCA cycle)
    SeSA_A0172 (aceF)
   00620 Pyruvate metabolism
    SeSA_A0172 (aceF)
Enzymes [BR:sew01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SeSA_A0172 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N GCV_H NQRA HlyD_D23 HlyD_3 DUF1223
Motif
Other DBs
NCBI-ProteinID: ACF91208
UniProt: A0A0N1QXJ7
Position
178805..180691
Genome map
AA seq 628 aa AA seqDB search
MAIEIKVPDIGTDEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKVS
VGDKTETGALIMIFDSADGAADAAPAKAEEKKEAAPAAAPAAAAAKDVHVPDIGSDEVEV
TEVMVKVGDTVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVNTGDKVSTGSLIMVFEVA
GAAPAAAPAKAEAAPAAAAPAATGVKDVNVPDIGGDEVEVTEVMVKVGDKVAAEQSLITV
EGDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIMVFEVEGAAPAAAPAKQEAAAPAPAA
KAEKPAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFGVNLAKVKGTGRKGRILREDVQ
AYVKDAIKRAEAAPAAAGGGIPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLSRNWVM
IPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKYTPVVFIMKAVAAALEQMPRFNSSLS
EDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKSVTELSRELTTISKKARDGKLTAGE
MQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFVPRLMMPISLSFD
HRVIDGADGARFITIINNMLSDIRRLVM
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcgggacagatgaagttgaaatcaccgagatt
ctggtcaaagtgggcgacaaagtggaagctgaacagtcgctgatcaccgtagaaggcgac
aaagcctctatggaagtcccgtctccgcaggctggcgtcgtgaaagagatcaaagtctct
gtcggcgacaaaaccgagaccggtgcacttatcatgattttcgattccgccgacggtgca
gctgacgctgcacctgctaaggcagaagagaagaaagaagcggctccggcagcagcacct
gctgcggcagcggcgaaagacgttcacgttccggatatcggcagtgacgaagttgaagtg
actgaagtgatggtgaaagtgggcgacaccgttgaagctgaacagtcgctgatcaccgtc
gaaggtgacaaggcctctatggaagtgccggcgccgttcgcgggcaccgtgaaagagatc
aaagtgaacaccggtgataaagtgtctaccggctcactgattatggtcttcgaagtggcg
ggcgcagcgcctgccgcagcaccagcgaaagcggaggccgctccggcagcggctgctcca
gcagcgacgggcgtgaaagacgttaacgtaccggacatcggcggcgacgaagttgaagtc
accgaagtgatggtcaaagtcggcgataaagttgccgctgaacagtcgctgatcaccgtg
gaaggcgacaaagcctccatggaagtgcctgcgccgttcgcgggcaccgtgaaagaaatc
aaaatcagcaccggcgacaaagtgaaaaccggttctctgattatggtcttcgaagtagaa
ggcgcagcgcctgcggccgctccggctaaacaggaagcggcggcaccggctccggcggcg
aaagctgagaagcctgctgccccggctgccaaagcggaaggcaagtctgagttcgctgaa
aacgacgcttacgttcacgctactccgctgattcgccgcctggcgcgtgagtttggcgtc
aacctggcgaaagtgaaagggactggtcgtaaaggccgtattctgcgcgaagacgttcag
gcttacgtgaaagatgctatcaaacgcgcggaagctgcgccggctgctgcgggcggcggt
atcccgggtatgctgccgtggccgaaagtggacttcagcaagtttggtgaagttgaagaa
gtggaactgggccgtatccagaaaatctctggcgcgaacctgagccgtaactgggtgatg
atcccgcacgttacgcacttcgacaaaaccgatatcaccgatctggaagcgttccgtaaa
cagcagaacgccgaagctgagaagcgcaaactggatgtgaaatacacgccagtggtcttc
atcatgaaagcggttgccgctgctctggaacagatgccgcgcttcaacagctctctgtcc
gaagacggtcagcgtctgaccctgaaaaaatatatcaacatcggcgtggcggttgatacc
ccgaatggcctggtggttccggtctttaaagacgtgaataagaagagcgtgaccgagctg
tctcgcgaactgaccaccatctccaaaaaagcgcgtgatggtaagctgaccgctggcgaa
atgcagggtggttgcttcactatctccagcatcggcggcctgggaactacccacttcgcg
ccgattgttaacgcgccggaagtggctatcctcggcgtttctaagtcggcgatggaaccg
gtgtggaatgggaaagagtttgtgccgcgtctgatgatgcctatctctctttccttcgac
caccgtgtgatcgatggtgctgatggtgcgcgtttcattaccattatcaacaatatgttg
tctgacattcgccgtctggtgatgtaa

DBGET integrated database retrieval system