KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A0411Help
Entry
SeSA_A0411        CDS       T00743                                 

Definition
type III restriction-modification system StyLTI enzyme res (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
418084..421053
Genome map
AA seq 989 aa AA seqDB search
MNILLEELPHQEQALAAILASFTGIDHAQADHNHYANPLIKGRYDDKANIDVKMETGTGK
TYVYTRLMYELHQNYGLFKFVLVVPTPAIKEGARNFITSDYARQHFSQFYENTRMELCTI
NAGDFKVKSGRKNFPAQLLSFTDASRRDSHTIQVLLINAQMLNSASMTRDDYDQTLLGGL
TSPVKGLQMTRPVVIIDEPHRFARDNKFYRAIQAIQPQMIVRFGATFPDIVEGKGKNKCV
RKDYYRRQPQFDLNAVDSFNDGLVKGIDIYYPNLPEEQANNRYIVDSVTAKKLILRRGGK
IAEVGVGENLADVDAGFEGSIEYAGSKMLSNDLELEAGMALVPGTFGASYQELIIQDAID
KHFDTEQANFLRSNEPENNAPRIKTLSLFFIDSIKSYRDDEGWLKVTFERLLKKKLTQLI
DDYQRKTLPREVEYLSFLQATLASLHSDNQNVHAGYFGEDRGSGDEAIQAEVDDILKNKE
KLLSFSDHHGNWETRRFLFSKWTLREGWDNPNVFVIAKLRSSGSESSKIQEVGRGLRLPV
DENGHRVHQEEWPSRLSFLIGYDEKTFASMLVDEINRDSKVQLNEQKLDEAMITLIVTER
QKVDPAFTELRLLEDLDDKKLINRSNEFKPSVTLNGETKSGFAWLLEFYPELTQARVRAD
RIRDNKPASRLRVRLRKENWEQLSSIWEQFSRRYMLQFERSGASLEQIAAEVLRDPALYI
RQKPSQVQQRLVSNEDNGRFEVAQREGELAASEFMAGMKYGHFLKQLALRTSLPVNVLHP
VLMAMLRDVLHGDSRYLSEISLDNMTRALQARINAHFAQRHDYLPLDFQASTSVFDSTAR
QFREEISAEIVGKNVDENAIDDPRSLYQIPPLRYDSVDPELPLLKYDYPQQVSVFGKLPK
RAIQIPKYTGGSTTPDFVYRIERQDADSVYLLVETKAENMRVGDQVILDAQRKFFDMLRR
QNINVEFAEATSAPAVFSTINGLIEGKVN
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atgaatattttactggaagaacttccccatcaggaacaggcgttagcggcgattctggcg
agtttcaccggtatcgatcacgcgcaggccgatcataatcactatgctaatccgctgatt
aagggacgttacgacgataaggccaatattgacgttaaaatggagaccgggacgggcaaa
acctatgtctatacccggttgatgtatgaactgcatcagaactacgggctcttcaaattt
gtgctggtggtgccgacgccagccattaaagaaggcgcgcggaactttatcaccagcgat
tacgccagacagcatttttcacagttctacgaaaatacgcggatggaactttgcaccatt
aacgccggtgattttaaagtaaagtcggggcgtaaaaattttccggcccagctattaagt
tttaccgatgccagccgtcgtgatagccatacgattcaggttttgctgatcaatgcgcaa
atgctcaattccgccagtatgacgcgagacgattacgatcaaacgctcctgggcggactg
acgtcgcctgttaaagggctgcaaatgacgcgaccggtggtcattattgatgaaccgcat
cgttttgcgcgagataacaaattttatcgagcgattcaggccattcagccgcaaatgatc
gtccgctttggcgctaccttcccggatattgtcgaaggtaagggtaaaaataaatgtgta
cgtaaagattactatcgccggcaaccgcagtttgatctcaacgcggtggacagttttaac
gatggtttggtgaaaggtattgatatttattacccgaatctccccgaagaacaggccaac
aatcgttatatcgttgacagcgtcacggcaaagaaattaatcctccgacgggggggcaaa
attgccgaggttggcgtgggcgaaaatctcgccgatgtcgatgcaggatttgaaggcagt
atcgaatatgccggcagtaaaatgttgtcgaacgatctggagctggaggcagggatggcg
ctggtgccaggaacctttggcgcgagctaccaggaactgattattcaggacgccattgat
aagcattttgacaccgagcaggcaaatttcttacgcagcaatgagccagaaaataatgcc
ccgcgtattaagaccttaagccttttctttattgacagtattaaaagctatcgtgatgac
gaaggctggttgaaagtcacttttgagcgtttgctgaaaaagaaactgacgcaactgatt
gacgattatcagcgcaagaccctgccgcgagaagtggagtatctgtcgtttctgcaggcc
acgctcgccagcctgcactcggataaccaaaacgtccacgctggttactttggcgaagac
cggggaagcggcgatgaggcgatccaggctgaggtagatgatattctgaaaaataaagag
aagttgctcagtttttcagaccatcacggcaactgggaaacgcgccgctttctgttttca
aaatggacgcttcgcgaaggctgggataacccgaatgtttttgtcattgctaaattacgt
tcttccggtagcgagtcgagcaaaattcaggaagtggggcgcggcctgcggctaccggta
gatgaaaacggtcatcgcgttcatcaggaagagtggccgtcccggctgtcgtttctgatt
ggttatgatgaaaaaacgtttgccagtatgctggttgatgagattaatcgcgacagcaaa
gttcagcttaacgagcagaaactggatgaggcgatgatcacactcatcgtcaccgagcga
caaaaagtcgatcctgcgtttacggagcttcgtttgctggaagatctggatgataaaaaa
ctgatcaaccggagtaatgagtttaaacccagcgtcacgcttaacggagaaaccaaaagt
ggttttgcgtggctactggagttctaccctgagctgacgcaggcgcgggtgcgagcggat
cgtattcgtgacaataagcccgcctcccggctgcgagtcaggttacgcaaagagaattgg
gaacaacttagcagtatctgggagcagttttcccgccgttatatgctgcaattcgagcgt
agcggcgcttctttggaacagattgccgccgaggtgctgcgcgatccggcgctgtatata
cgccagaagccaagccaggtgcaacaacggctggtatcgaatgaagataatggccgtttt
gaagtggcgcagcgggaaggcgaattagccgccagcgaatttatggcgggcatgaaatat
ggccattttcttaagcaactggcgttacgtaccagtctgccggttaacgtcctgcacccg
gtgttaatggcgatgctgcgtgatgttttgcacggagattcacgttatttaagcgagatc
tcgttggacaatatgacccgcgcattacaggcgcggattaatgcgcattttgcgcagcgc
cacgattatctgcctctcgattttcaggcttcaacgtcggtatttgattccacggcacgg
cagttcagagaggagattagcgctgaaattgtggggaaaaatgtggatgagaatgcgata
gatgatccccgttctctctatcaaataccgccgttgcgttatgacagcgtcgatccagaa
ttgccgctattaaaatacgattatccgcaacaggtttctgtgtttggcaaattgcctaag
cgggccattcagatccccaaatatacggggggctctactacgccggattttgtgtaccgt
attgagcgtcaggacgccgacagtgtttatttactggttgaaactaaagcagaaaatatg
cgcgtaggcgatcaggttattcttgatgcgcaacgtaaattcttcgatatgctgcgtcgg
caaaatatcaatgtcgagtttgcggaagcgaccagcgcgccggcggtattttctacgatc
aatggtttgattgaggggaaggtaaactaa

DBGET integrated database retrieval system