KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A0629Help
Entry
SeSA_A0629        CDS       T00743                                 

Definition
phage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Brite
Enzymes [BR:sew01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SeSA_A0629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
618243..618740
Genome map
AA seq 165 aa AA seqDB search
MNSTLRKSVLAAVGGGAIAIASALITGPTGNDGLEGVSYIPYKDIVGVWTVCHGHTGKDI
MLGKTYTEAECKALLNKDLATVARQINPYIKVDIPETTRGALYSFVYNVGAGNFRTSTLL
RKINQGDIKGACDQIRRWTYAGGKQWKGLMTRREIEREVCLWGQQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcacccttcgaaaaagcgtactggcagccgttggtggtggggctatcgcaata
gcttctgcactgattactgggccaactggtaatgatggtctggaaggtgtcagctacata
ccatacaaagatattgttggtgtatggactgtatgtcacggacacaccggaaaagacatc
atgctcggtaaaacgtataccgaagcagaatgcaaagccctcctgaataaagaccttgcc
acggtcgccagacaaattaacccgtacattaaagtcgatataccggaaacaacgcgcggc
gctctttactcgttcgtctacaacgtgggtgctggcaatttcagaacatcgacgcttctt
cgcaaaataaaccagggcgatatcaaaggcgcatgtgatcagatacggcgctggacatac
gctggcggtaagcaatggaaagggctgatgactcgccgtgagattgagcgtgaagtctgt
ttgtgggggcagcaatga

DBGET integrated database retrieval system