KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A0835Help
Entry
SeSA_A0835        CDS       T00743                                 

Gene name
asnB
Definition
asparagine synthetase B (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sew00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(804490..806154)
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVFDIKTDAAELRKKALELSRLMRHRGPDWSGIYACDNAILAHERLSIVDVNAGA
QPLYNARKTHVLAVNGEIYNHQTLRAEYGDRYAFQTGSDCEVILALYQEKGPDFLDDLQG
MFAFALYDSEKDAYLIGRDHIGIIPLYMGYDEFGNFYVASEMKALTPVCRTIKEFPAGSY
LWSKDGEIRQYYQRDWFDYDAVKDNVTDKNALRQALEESVKSHLMSDVPYGVLLSGGLDS
SIISAITKKFAARRVEDQERSEAWWPQLHSFAVGLEGSPDLKAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLQALHMYDCARANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KMCGNGKMEKHVLRECFESYLPASVAWRQKEQFSDGVGYSWIDTLKEVAAKQISDQQLET
ARFRFPYNTPSSKEAYLYREIFEELFPVPSAAECVPGGPSVACSSAKAIEWDEAFKTMDD
PSGRAVGVHQSAYQ
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctattttcggcgtattcgatatcaaaacagatgcagcggaactgcgtaaaaaa
gcccttgaactgtcacgcctgatgcgccatcgcggcccggactggtccggcatctacgct
tgcgataacgcgattctcgcacatgaacgcttgtcgattgttgatgttaacgccggcgcc
cagcccctgtataacgccagaaaaacccacgtactggcggtgaacggtgaaatttataac
catcagacgttacgcgcggagtatggcgatcgttacgcgttccagacaggctccgactgc
gaagttatcctcgcgctatatcaggaaaaagggccggatttccttgacgatttacagggg
atgttcgccttcgccctgtatgacagcgaaaaagacgcttatctgattggtcgtgaccat
atcggtattattccgctctacatgggctatgacgaattcggcaacttctacgtagcgtca
gaaatgaaagcgctgaccccggtctgccgcaccattaaagagttcccggcgggcagctac
ctgtggagcaaagacggcgaaattcgtcagtactatcagcgcgactggttcgattacgat
gcggtaaaagacaacgttaccgacaaaaacgcgctgcgccaggcgctggaagaatccgtg
aaaagccacctgatgtccgacgtcccttacggcgtgctgctctccggcggtctggactcg
tcgattatctcggctatcaccaaaaaattcgccgcccgtcgcgtcgaagatcaggagcgc
tccgaagcctggtggccacagttgcactcttttgcggtcggtctggaaggttcgcctgac
ctgaaggcggcccaggaagtggctaaccacctcggcaccgtgcatcatgaaattcacttc
accgtgcaggaaggccttgatgccattcgtgatgttatctaccacatcgaaacctatgac
gtgaccactatccgcgcctcaacgccgatgtatctgatgtcgcgtaagatcaaagcgatg
ggcatcaaaatggtgctctccggcgaaggctccgatgaggtgtttggcggctacctgtac
ttccataaagcgccgaacgccaaagagttacatgaagagacggtccgtaagctacaggcg
ctgcatatgtatgactgcgcccgcgccaacaaagcgatgtccgcctggggcgtggaagcg
cgcgtaccgttcctggataaaaaattcctcgacgtggcgatgcgtatcaacccacaggat
aaaatgtgcggcaacggcaagatggaaaaacacgtgctgcgcgagtgcttcgagtcttat
ctgccagcaagcgtcgcgtggcgtcagaaagagcagttctctgacggcgtaggctacagc
tggattgatacgctgaaagaggtggcggcgaaacagatttccgatcaacaactggaaacc
gcccgcttccgctttccatacaacacgccgtcgtctaaagaagcgtacttgtaccgggaa
atttttgaagagctgttcccggtgccaagcgcggcggaatgcgtacccggcggcccgtcc
gtcgcctgttcttccgccaaagccattgagtgggatgaagcattcaaaacgatggatgac
ccatcaggccgcgcggtcggcgtgcatcagtcggcgtaccagtaa

DBGET integrated database retrieval system