KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A0889Help
Entry
SeSA_A0889        CDS       T00743                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
sew00020  Citrate cycle (TCA cycle)
sew00190  Oxidative phosphorylation
sew00650  Butanoate metabolism
sew01100  Metabolic pathways
sew01110  Biosynthesis of secondary metabolites
sew01120  Microbial metabolism in diverse environments
sew01130  Biosynthesis of antibiotics
sew01200  Carbon metabolism
Module
sew_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sew_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sew_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sew00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SeSA_A0889 (sdhD)
   00650 Butanoate metabolism
    SeSA_A0889 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    SeSA_A0889 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACF88687
UniProt: A0A0N1QS46
Position
864124..864471
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTFEAWTGFFSSAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLAVRLILQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgacttcatcctggtccgt
gctaccgctatcgttctgacgttatacatcatctacatggtgggttttttcgccacgagc
ggcgaactgacctttgaagcctggaccggtttcttctcatcggccttcaccaaagtcttc
accctgctggcgcttttttccatcttgattcatgcctggatcggcatgtggcaggtgtta
accgactacgttaaaccactagcagtgcgtctgatactgcaactcgttattgttgttgcg
ctggtggtttacgtcatctatggatttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system