KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A1167Help
Entry
SeSA_A1167        CDS       T00743                                 

Gene name
hpaD
Definition
3,4-dihydroxyphenylacetate 2,3-dioxygenase (EC:1.13.11.15)
Orthology
K00455  
3,4-dihydroxyphenylacetate 2,3-dioxygenase [EC:1.13.11.15]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
Tyrosine metabolism
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Homoprotocatechuate degradation, homoprotocatechuate => 2-oxohept-3-enedioate
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:sew01220]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:sew00350]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1149646..1150497
Genome map
AA seq 283 aa AA seqDB search
MGKLALAAKITHVPSMYLSELPGKNHGCRQAAIDGHIEIGKRCREMGVDTIIVFDTHWLV
NSAYHINCADHFQGVYTSNELPHFIRDMTYDYDGNPELGHLIADEAVKLGVRAKAHNIPS
LKLEYGTLVPMRYMNSDKHFKVVSISAFCTVHDFADSRRLGEAILKAIEKYDGTVAVFAS
GSLSHRFIDDQRAEEGMNSYTREFDHQMDERVVKLWREGKFKEFCTMLPEYADYCYGEGN
MHDTVMLLGMLGWDKYDGKVEFITDLFASSGTGQVNAVFPLPA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagttagcgttagcagcaaaaattacccacgtgccgtcgatgtatctttctgaa
ctgccgggaaaaaatcacggttgtcgtcaggcagccattgatgggcatattgaaattggc
aagcgttgccgcgaaatgggcgttgacaccattatcgtattcgacacccactggctggtg
aatagcgcttaccacattaattgtgccgaccatttccagggcgtctataccagcaacgaa
ttgccgcactttattcgcgacatgacctatgactatgacggtaatccggagctcggccac
ctgatcgccgacgaggcagtcaaactgggcgtgcgcgctaaagcgcataacatcccgagc
ctgaagctggagtatggcacgctggtaccgatgcgctacatgaacagcgacaagcacttc
aaagtggtctccatctcggcgttctgcactgtgcatgattttgccgacagccgcagactg
ggcgaagccattctcaaggcgattgagaaatatgacggtaccgtagcggtattcgccagt
ggttctctgtcgcaccgttttattgacgaccaacgggcggaagaggggatgaacagctac
acccgcgagttcgatcatcagatggacgagcgcgtggtcaagctgtggcgcgaaggcaaa
ttcaaggagttttgcaccatgttgccggagtacgccgactactgctacggcgaaggcaac
atgcacgacacggtcatgctgctgggaatgctgggttgggacaaatacgacggcaaggtg
gagttcatcaccgatctgttcgccagctccggtactggccaggtgaacgctgttttcccg
ctgcctgcgtaa

DBGET integrated database retrieval system