KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A1167Help
Entry
SeSA_A1167        CDS       T00743                                 

Gene name
hpaD
Definition
3,4-dihydroxyphenylacetate 2,3-dioxygenase (EC:1.13.11.15)
Orthology
K00455  
3,4-dihydroxyphenylacetate 2,3-dioxygenase [EC:1.13.11.15]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
Tyrosine metabolism
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Homoprotocatechuate degradation, homoprotocatechuate => 2-oxohept-3-enedioate
Brite
KEGG Orthology (KO) [BR:sew00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SeSA_A1167 (hpaD)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SeSA_A1167 (hpaD)
Enzymes [BR:sew01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.15  3,4-dihydroxyphenylacetate 2,3-dioxygenase
     SeSA_A1167 (hpaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1149646..1150497
Genome map
AA seq 283 aa AA seqDB search
MGKLALAAKITHVPSMYLSELPGKNHGCRQAAIDGHIEIGKRCREMGVDTIIVFDTHWLV
NSAYHINCADHFQGVYTSNELPHFIRDMTYDYDGNPELGHLIADEAVKLGVRAKAHNIPS
LKLEYGTLVPMRYMNSDKHFKVVSISAFCTVHDFADSRRLGEAILKAIEKYDGTVAVFAS
GSLSHRFIDDQRAEEGMNSYTREFDHQMDERVVKLWREGKFKEFCTMLPEYADYCYGEGN
MHDTVMLLGMLGWDKYDGKVEFITDLFASSGTGQVNAVFPLPA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagttagcgttagcagcaaaaattacccacgtgccgtcgatgtatctttctgaa
ctgccgggaaaaaatcacggttgtcgtcaggcagccattgatgggcatattgaaattggc
aagcgttgccgcgaaatgggcgttgacaccattatcgtattcgacacccactggctggtg
aatagcgcttaccacattaattgtgccgaccatttccagggcgtctataccagcaacgaa
ttgccgcactttattcgcgacatgacctatgactatgacggtaatccggagctcggccac
ctgatcgccgacgaggcagtcaaactgggcgtgcgcgctaaagcgcataacatcccgagc
ctgaagctggagtatggcacgctggtaccgatgcgctacatgaacagcgacaagcacttc
aaagtggtctccatctcggcgttctgcactgtgcatgattttgccgacagccgcagactg
ggcgaagccattctcaaggcgattgagaaatatgacggtaccgtagcggtattcgccagt
ggttctctgtcgcaccgttttattgacgaccaacgggcggaagaggggatgaacagctac
acccgcgagttcgatcatcagatggacgagcgcgtggtcaagctgtggcgcgaaggcaaa
ttcaaggagttttgcaccatgttgccggagtacgccgactactgctacggcgaaggcaac
atgcacgacacggtcatgctgctgggaatgctgggttgggacaaatacgacggcaaggtg
gagttcatcaccgatctgttcgccagctccggtactggccaggtgaacgctgttttcccg
ctgcctgcgtaa

DBGET integrated database retrieval system