KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A1387Help
Entry
SeSA_A1387        CDS       T00743                                 

Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.19 3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sew00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SeSA_A1387
Enzymes [BR:sew01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     SeSA_A1387
    3.5.1.-  
     SeSA_A1387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1337787..1338443)
Genome map
AA seq 218 aa AA seqDB search
MTNRALLLVDLQNDFCAGGALAVAEGDSTIDIANALIDWCQPRQIPVLASQDWHPAQHGS
FASQHQAEPYSQGKLDGLPQTLWPDHCVQHTDGAALHPLLNQHAIDACIFKGENPLIDSY
SAFFDNEHRQKTTLDTWLREHDVTELIVMGLATDYCVKFTVLDALELGYAVNVITDGCRG
VNIHPQDSAHAFMEMAAAGATLYTLADWEETQGQAVAR
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaccgggccttattactggtcgacttgcaaaatgacttttgcgccggcggcgcg
ctggctgtagcggaaggcgacagcaccatcgacatcgccaacgctcttattgactggtgc
cagccccggcagattccggtgctggccagccaggactggcatcccgcgcagcatggcagc
ttcgccagccagcatcaggcggaaccctatagtcagggaaagctggacgggctgccgcaa
acgctctggccggatcactgcgttcaacataccgacggcgcggcgttacatcccctgctt
aaccaacatgcgattgacgcctgcatctttaagggtgaaaacccgctgattgatagctac
agcgcgttttttgacaacgaacatcggcagaaaactacccttgatacctggcttcgcgag
catgacgttaccgagcttatcgtgatggggttggcgaccgattactgcgtaaaatttacg
gtgctggatgcgctagagttgggctatgccgttaacgttatcaccgatggctgtcgcggc
gtgaatattcacccgcaggatagcgcacacgcgtttatggagatggcggcggcaggcgcg
acgctgtatacgctggcagactgggaagagacgcagggccaggctgtcgccaggtag

DBGET integrated database retrieval system