KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A1423Help
Entry
SeSA_A1423        CDS       T00743                                 

Gene name
pfkB
Definition
6-phosphofructokinase (EC:2.7.1.56)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sew00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SeSA_A1423 (pfkB)
   01230 Biosynthesis of amino acids
    SeSA_A1423 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeSA_A1423 (pfkB)
   00030 Pentose phosphate pathway
    SeSA_A1423 (pfkB)
   00051 Fructose and mannose metabolism
    SeSA_A1423 (pfkB)
   00052 Galactose metabolism
    SeSA_A1423 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    SeSA_A1423 (pfkB)
Enzymes [BR:sew01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SeSA_A1423 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1371615..1372547)
Genome map
AA seq 310 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCSAPVFEPGGGGINVARAIAHLGGAATAIFP
AGGATGEHLVALLADENVPVSTVDAKDWTRQNLHVHVESSGEQYRFVMPGATLDDDEFRQ
LEEQVLEIESGAILVISGSLPPGVKVEKLTQLISAAQKQGIRCIIDSSGDALTAALALGD
IELVKPNLKELSALVNRDLTQPDDVRKAAQELVQSGKARRVVVSLGPQGALGIDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAQDASLEEMVRFGVAAGSAATLNQGTRLCSRDDT
QKIYAYLSAQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacgcttgcgccctctctcgatagcgcaacaatcacgccg
caaatttatcccgaaggtaaactgcggtgctccgcgccggtattcgaacccggcggcggg
ggtattaatgtcgctcgcgccattgcgcatcttggcggcgccgcgaccgcaattttcccg
gctggcggcgctaccggcgaacatctggtcgcactactggctgacgaaaatgtccccgtg
tctaccgtcgatgcgaaagactggacgcgtcagaacctgcacgtccacgtcgagtccagc
ggcgaacagtatcgttttgttatgcccggcgccacgctggacgatgacgaatttcgccag
cttgaagaacaggtactggaaattgaatccggggcaattctggttatcagcggcagcctt
ccgcccggcgttaaggtcgagaaactcacgcaactgatttccgccgcgcagaagcaaggc
attcgctgcattattgatagctctggcgacgcgctcaccgccgcgctggcgcttggcgat
atcgaactggtgaaaccgaacctgaaagaattgagcgcgttggttaatcgcgatctgacg
caacctgatgatgtgcgtaaagcggcccaggaattagtgcaaagcggcaaggctcgccgg
gtagtggtctctctggggccgcaaggggcactgggcatagacagtgagaattgcatccag
gttgttcctcccccggtgaaaagtcaaagtactgttggcgcaggcgacagtatggtaggc
gcgatgacgttaaaactggcgcaagacgcgtcgctggaagagatggtgcgcttcggtgtg
gcggcaggcagcgctgctacgctcaatcaaggtacgcgtctgtgttctcgtgacgatacc
caaaaaatatacgcctatctttccgcgcaataa

DBGET integrated database retrieval system