KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A2327Help
Entry
SeSA_A2327        CDS       T00743                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sew00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SeSA_A2327 (rfbC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SeSA_A2327 (rfbC)
Enzymes [BR:sew01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SeSA_A2327 (rfbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2196661..2197209)
Genome map
AA seq 182 aa AA seqDB search
MIVIKTAIPDVLILEPKVFGDERGFFFESYNQQTFEESIGRKVTFVQDNHSKSKKNVLRG
LHFQRGENAQGKLVRCAVGEVFDVAVDIRKESPTFGQWVGVNLSAENKRQLWIPEGFAHG
FVTLSEYAEFLYKATNYYSPSSEGSILWNDETIGIEWPFSQLPELSAKDAAAPLLHQALL
TE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgattgtgattaaaacagcaataccagatgtcttgatcttagagcctaaagtttttggc
gatgagaggggattcttttttgaaagttataaccagcagacctttgaagagtcgattgga
cgtaaagttacatttgttcaagataatcattcaaaatccaaaaagaacgtactcagaggg
ttgcattttcagagaggagaaaatgcacagggtaagttagttcgttgtgctgtcggtgag
gtttttgatgttgcggtcgatatccgaaaagaatcgcctacttttggtcagtgggttggc
gtaaatctatctgctgagaataagcgacagctttggattccagaaggttttgctcatggt
tttgttactcttagtgagtatgcagagtttctgtacaaagcaactaattattactcacct
tcatcggaaggtagcattctatggaatgatgagacaataggtattgaatggcctttttct
cagctgcctgagctttcagcaaaagatgctgcagcacctttactgcatcaagccttgtta
acagagtaa

DBGET integrated database retrieval system