KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A3138Help
Entry
SeSA_A3138        CDS       T00743                                 

Gene name
fucI
Definition
L-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sew00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3032496..3034271
Genome map
AA seq 591 aa AA seqDB search
MKKISLPKIGIRPVIDGRRMGVRESLEEQTMNMAKATAALITEKIRHACGAQVECVIADT
CIAGMAESAACEEKFSSQNVGVTITVTPCWCYGSETIDMDPMRPKAIWGFNGTERPGAVY
LAAALAAHSQKGIPAFSIYGHDVQDADDTSIPADVEEKLLRFARAGLAVASMKGKSYLSV
GGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFRY
GEDQNASQYKRNEAQNRAVLKESLLMAMCIRDMMQGNKTLADKGLVEESLGYNAIAAGFQ
GQRHWTDQYPNGDTAEALLNSSFDWNGIREPFVVATENDSLNGVAMLFGHQLTGTAQIFA
DVRTYWSPEAVERVTGQALSGLAEHGIIHLINSGSAALDGACKQRDSEGKPTMKPHWEIS
QQEADACLAATEWCPAIHEYFRGGGYSSRFLTEGGVPFTMTRVNIIKGLGPVLQIAEGWS
VELPKAMHDQLDARTNSTWPTTWFAPRLTGKGPFTDVYSVMANWGANHGVLTIGHVGADF
ITLAAMLRIPVCMHNVEEAKIYRPSAWAAHGMDIEGQDYRACQNYGPLYKR
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcagcttaccgaaaatcggtatccgcccggtgattgatggacgtcgtatg
ggcgtacgcgagtcgctcgaagagcaaaccatgaacatggcgaaagcgacggcggcgctc
atcaccgagaaaatccgccacgcctgcggggcacaggtggagtgcgtcattgcagatacc
tgtattgccggaatggcggaatccgccgcctgtgaagaaaaattcagtagccagaacgtg
ggcgtgaccattaccgttacgccgtgttggtgctatggcagcgaaaccattgatatggac
ccgatgcgtccgaaagccatctggggctttaacggcacagagcgtcccggggcggtttac
cttgccgcggcgctggcggcgcacagccagaaaggcattccggcgttctccatttatggc
catgacgtgcaggatgccgacgatacctccattcccgccgacgtcgaagaaaaactgctg
cgttttgcgcgggcagggttagcggtagccagcatgaaaggcaaaagctacctctccgtc
ggcggcgtgtcgatggggatcgcgggttccattgtcgatcataacttctttgaatcctgg
ctgggcatgaaggtgcaagcggtagatatgaccgaactgcgccgccgtatcgatcaaaaa
atttatgatgaagccgaactggagatggcgctggcgtgggcggataaaaacttccgctac
ggcgaagatcagaatgcctcgcagtataagcgcaatgaagcccagaaccgcgcggtgcta
aaagagagcctgctgatggcgatgtgtattcgcgatatgatgcagggcaacaagacgctg
gcggacaaagggttagttgaagaatcgctgggctacaacgccattgccgccggcttccag
ggccagcgccactggaccgatcaatacccgaacggcgataccgccgaagcgctgctcaat
agttcttttgactggaacggcatacgcgaaccgtttgtcgtcgccaccgaaaatgacagt
ctgaacggcgtagcgatgctgtttggccatcaactcaccggtaccgcgcagatcttcgcc
gacgtgcgaacctactggtcgccggaagccgtagaacgcgtcaccggccaggcgcttagc
ggactggcggagcatggcattattcacctgattaactccggttctgccgctctggacggt
gcctgtaaacagcgcgacagcgaaggcaagccgactatgaaaccgcactgggaaatcagc
caacaagaggcggatgcgtgtctggcggccaccgaatggtgcccggcgattcacgaatac
ttccgcggcggcggctactcatcccgtttcctgaccgaaggcggcgtgccattcaccatg
acccgcgtgaatatcatcaaaggcctggggccagtactgcaaatcgccgagggctggagc
gtcgaactgccgaaagcgatgcacgatcagctcgatgcccgcaccaactctacctggcct
accacctggtttgcgccgcgtcttaccggcaaaggcccgtttaccgatgtctattcggtg
atggcgaactggggcgctaaccacggcgtactcaccatcggccatgtaggggcggacttt
attactctcgccgcgatgctgcgtatcccggtatgtatgcacaacgtggaggaggcgaag
atctaccgtccttccgcctgggcggctcacggtatggatatcgaaggccaggattatcgt
gcctgccagaattatggcccgctgtataaacgttaa

DBGET integrated database retrieval system