KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A3165Help
Entry
SeSA_A3165        CDS       T00743                                 

Gene name
thyA
Definition
thymidylate synthase (EC:2.1.1.45)
Orthology
K00560  
thymidylate synthase [EC:2.1.1.45]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
Pyrimidine metabolism
One carbon pool by folate
Metabolic pathways
Module
Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sew00240]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:sew00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3062293..3063087)
Genome map
AA seq 264 aa AA seqDB search
MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQEGFPLVTTKRCHLRSIIHELL
WFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQIATVLSQLK
NDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIAS
YALLVHMMAQQCDLDVGDFVWTGGDTHLYSNHMEQTHLQLSREPRALPKLVIKRKPDSLF
DYRFDDFEIEGYDPHPGIKAPVAI
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagtatttagaactgatgcaaaaagtgctggatgaaggcacacagaaaaacgac
cgtaccggcaccggcacgctttccatttttggccatcagatgcgttttaacctgcaggaa
ggctttccgctggtgacgacaaaacgctgccatttacgttcaattattcacgaactgcta
tggtttttgcagggcgataccaacatcgcttacctgcacgaaaataatgtcaccatctgg
gacgaatgggccgatgagaacggcgatttaggcccggtttatggtaagcagtggcgtgca
tggccaacaccggatggccgccatatcgatcagatcgccacggtcttaagccagcttaaa
aacgacccggactctcgtcgtattatcgtttctgcgtggaacgtcggcgagctggataag
atggcgctggcgccgtgtcacgcctttttccagttttatgtcgcagatggaaaactctcc
tgtcagctttatcagcgctcctgcgatgtgttcctcggtctgccgttcaacattgccagc
tacgcgttactggtgcatatgatggcgcaacagtgcgacctggacgtcggcgattttgtc
tggaccggcggcgacacgcacctgtacagcaaccatatggagcagacgcacctgcaatta
agccgtgaaccgcgcgcgctgccgaagttggtcattaagcgtaaacctgattcgcttttt
gactaccggttcgatgatttcgaaattgaaggctatgatccgcaccccggtattaaagcg
ccggtcgctatctaa

DBGET integrated database retrieval system