KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A3665Help
Entry
SeSA_A3665        CDS       T00743                                 

Gene name
argD
Definition
bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase (EC:2.6.1.11 2.6.1.17)
Orthology
K00821  
acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
Lysine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Ornithine biosynthesis, glutamate => ornithine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:sew01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sew01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sew00300]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sew00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3516223..3517440)
Genome map
AA seq 405 aa AA seqDB search
MATEQTAITRATFDEVILPVYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCH
PALVEALKSQGETLWHTSNVFTNEPALRLGRKLIDATFAERVLFMNSGTEANETAFKLAR
HYACVRHSPFKTKIIAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVK
AVMDDHTCAVVVEPIQGEGGVQAATPEFLKGLRDLCDKHQALLVFDEVQCGMGRTGDLFA
YMHYGVTPDILTSAKALGGGFPVSAMLTTQEIASAFHVGSHGSTYGGNPLACAVAGAAFD
IINTPEVLQGIHTKRQQFVQHLQAIDEQFDIFSDIRGMGLLIGAELKPKYKGRARDFLYA
GAEAGVMVLNAGADVMRFAPSLVVEEADINEGMQRFAQAVGKVVA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgaacaaacggctattacgcgcgcaacttttgatgaggtgattctgcctgtt
tatgcaccggcggactttattccggtcaaaggtaaaggcagccgcgtatgggatcagcag
ggcaaagagtatatcgatttcgccggcgggattgcagtgactgcgctgggccattgccat
ccggcactggtcgaggcgctgaaatcccagggggaaaccttgtggcataccagtaacgtt
tttaccaatgaaccagcgttgcgtctgggacgtaaactgatcgacgccacgtttgccgag
cgcgtgctgtttatgaattccggcaccgaagcgaacgaaaccgcttttaaactggcgcgt
cattatgcctgcgtgcgccatagcccgttcaaaacgaaaatcattgccttccataacgcc
tttcatggccgttccttgtttaccgtctctgtcggcggacagccgaaatattccgacggc
tttgggccgaaacccgccgacattattcacgttcctttcaacgatcttcatgcggtgaaa
gcggtaatggatgaccacacctgcgcggtggtggtcgagccgattcagggggaaggcggc
gtgcaggcggctacaccggaattcctcaaagggttacgcgacctgtgtgacaagcatcag
gcgttgctggtgtttgatgaagtgcagtgcgggatggggcgcaccggagacctgtttgcc
tatatgcactacggcgtcacgccggatatcctcaccagcgccaaagcgttaggcggcggt
tttccggtgagcgccatgctgaccacgcaggagatcgcctcggccttccatgtcggttcg
catggttcaacctatggcggcaatccgctagcctgtgcggtggctggcgcggcattcgat
attattaatacgccagaggtactacaaggcattcacactaagcggcaacagtttgtgcaa
catttgcaggcgattgacgagcaatttgacattttcagcgatattcgcggcatggggctg
ctgattggcgcggaactgaagccgaagtacaaaggccgggcgcgcgattttctgtacgca
ggagcggaggccggcgtgatggtgctcaatgccggagccgacgtgatgcgttttgccccg
tcgctggtggtggaagaggcggatatcaatgaaggaatgcagcgctttgcgcaggcggta
gggaaggtggtggcctga

DBGET integrated database retrieval system