KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A3665Help
Entry
SeSA_A3665        CDS       T00743                                 

Gene name
argD
Definition
bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase (EC:2.6.1.11 2.6.1.17)
Orthology
K00821  
acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
Lysine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:sew00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SeSA_A3665 (argD)
   01230 Biosynthesis of amino acids
    SeSA_A3665 (argD)
  Amino acid metabolism
   00300 Lysine biosynthesis
    SeSA_A3665 (argD)
   00330 Arginine and proline metabolism
    SeSA_A3665 (argD)
Enzymes [BR:sew01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     SeSA_A3665 (argD)
    2.6.1.17  succinyldiaminopimelate transaminase
     SeSA_A3665 (argD)
Amino acid related enzymes [BR:sew01007]
 Aminotransferase (transaminase)
  Class III
   SeSA_A3665 (argD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3516223..3517440)
Genome map
AA seq 405 aa AA seqDB search
MATEQTAITRATFDEVILPVYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCH
PALVEALKSQGETLWHTSNVFTNEPALRLGRKLIDATFAERVLFMNSGTEANETAFKLAR
HYACVRHSPFKTKIIAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIIHVPFNDLHAVK
AVMDDHTCAVVVEPIQGEGGVQAATPEFLKGLRDLCDKHQALLVFDEVQCGMGRTGDLFA
YMHYGVTPDILTSAKALGGGFPVSAMLTTQEIASAFHVGSHGSTYGGNPLACAVAGAAFD
IINTPEVLQGIHTKRQQFVQHLQAIDEQFDIFSDIRGMGLLIGAELKPKYKGRARDFLYA
GAEAGVMVLNAGADVMRFAPSLVVEEADINEGMQRFAQAVGKVVA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgaacaaacggctattacgcgcgcaacttttgatgaggtgattctgcctgtt
tatgcaccggcggactttattccggtcaaaggtaaaggcagccgcgtatgggatcagcag
ggcaaagagtatatcgatttcgccggcgggattgcagtgactgcgctgggccattgccat
ccggcactggtcgaggcgctgaaatcccagggggaaaccttgtggcataccagtaacgtt
tttaccaatgaaccagcgttgcgtctgggacgtaaactgatcgacgccacgtttgccgag
cgcgtgctgtttatgaattccggcaccgaagcgaacgaaaccgcttttaaactggcgcgt
cattatgcctgcgtgcgccatagcccgttcaaaacgaaaatcattgccttccataacgcc
tttcatggccgttccttgtttaccgtctctgtcggcggacagccgaaatattccgacggc
tttgggccgaaacccgccgacattattcacgttcctttcaacgatcttcatgcggtgaaa
gcggtaatggatgaccacacctgcgcggtggtggtcgagccgattcagggggaaggcggc
gtgcaggcggctacaccggaattcctcaaagggttacgcgacctgtgtgacaagcatcag
gcgttgctggtgtttgatgaagtgcagtgcgggatggggcgcaccggagacctgtttgcc
tatatgcactacggcgtcacgccggatatcctcaccagcgccaaagcgttaggcggcggt
tttccggtgagcgccatgctgaccacgcaggagatcgcctcggccttccatgtcggttcg
catggttcaacctatggcggcaatccgctagcctgtgcggtggctggcgcggcattcgat
attattaatacgccagaggtactacaaggcattcacactaagcggcaacagtttgtgcaa
catttgcaggcgattgacgagcaatttgacattttcagcgatattcgcggcatggggctg
ctgattggcgcggaactgaagccgaagtacaaaggccgggcgcgcgattttctgtacgca
ggagcggaggccggcgtgatggtgctcaatgccggagccgacgtgatgcgttttgccccg
tcgctggtggtggaagaggcggatatcaatgaaggaatgcagcgctttgcgcaggcggta
gggaaggtggtggcctga

DBGET integrated database retrieval system