KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A3712Help
Entry
SeSA_A3712        CDS       T00743                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sew00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3568836..3570914)
Genome map
AA seq 692 aa AA seqDB search
MENKRLDSAALAAGISPSYINAHGKPQSIGAETKRRLLAAMHGTTTGPQAVVPNVKVYTA
GKKMALPVEGRGEFAWLLTTEEGVHYKGRVTGGKKLNLPATLPEGYHTLTLTQDEQRTHC
RIIVAPPRCYEPQALLEGKKLWGACVQLYTLRSEKNWGIGDFGDLKSMLVDVATRGGAFI
GLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFRLSEEAQAWWQMPATQQKLR
QARDAQWVDYATVTALKITALRMAWTRFAARDDAQMAEFRHFIAREGESLYWQAAFDALH
AYQAKEDEQRWGWPAWPEAYQSVESPAVKQFCEAHREEVEFYLWLQWLAWRQFAACWDTC
QSFKLPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMDPHI
IVARAYEPFIDLLRANMQNCGALRIDHVMSLLRLWWIPYGETADRGAYVQYPVDDLLAIL
ALESQRHRCMVIGEDLGTVPVEIVGKLRDSGVYSYKVLWFENDLEKNFRAPGAYPQQSMA
VASTHDLPTLRGYWECGDLTLGKALGLYPDEVILRGLYEDRERAKQGLLDALHKYGCLPK
RAGHKASLMSMTPTLNRGLQRYIADSNSGLLGLQPEDWLDMADPVNVPGTSDQYKNWRRK
LTATLEQMFADEGVNKLIKDLDKRRKAAAKKK
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaacgtctcgatagtgccgcgctggcggcggggatcagccccagttacatc
aatgctcatggcaaaccgcagtctattggcgctgaaaccaagagacgtttgctggcggcg
atgcacggcacgacaacaggaccacaggcggtcgtgccgaatgtgaaggtttataccgcg
ggtaaaaaaatggcgttgccggtagaggggcgcggtgagtttgcctggctgctgactacg
gaagagggcgtgcattacaaagggcgcgtgacgggcggtaaaaaacttaaccttccggct
acattgccggagggctaccacaccctgacgttgacccaggatgaacagcgtacgcactgc
cgtattatcgtcgccccgccgcgatgctatgagccgcaggcgctactggaagggaaaaaa
ctgtggggggcctgcgtccagctttatactctgcgttcagaaaaaaactggggtattggc
gatttcggcgatttaaagtcgatgctggtcgacgtggcgacacgcggcggcgcgtttatc
ggcctgaacccgatccacgcgctttatccggcgaatccggagagcgccagtccctacagc
ccctcgtctcgtcgctggctgaacgtgatatatatcgacgtcaatgccgtcgaagatttc
cgcctgagcgaagaggctcaggcatggtggcaaatgcccgccacacagcaaaagctgcga
caggcgcgcgatgcgcaatgggtggattacgctaccgttaccgcgctgaaaatcacggcg
ttgcggatggcgtggacgcgctttgccgctcgcgacgatgcgcaaatggcggagtttcgt
cactttatcgcccgtgaaggcgagagcctttactggcaggcggcattcgacgcgctgcat
gcgtatcaggcgaaagaggatgagcagcgctggggctggccagcctggccggaggcgtac
cagtcggtagagtctcccgctgtaaaacaattctgtgaagcgcaccgcgaagaggtggag
ttttacctctggcttcagtggctggcctggcgccaattcgccgcctgctgggatacctgc
cagagttttaaactaccgattggtctgtaccgcgatctggcggttggcgtagcggaaggc
ggcgcggaaacctggtgcgaccgggagctgtactgcctgaaagcatctgtcggcgcgccg
ccggatatcctcggcccgctcggtcagaactgggggctgccgccaatggacccgcatatc
attgtcgcccgggcgtatgagccctttatcgacctgctgcgcgccaatatgcaaaactgc
ggcgcgttgcgcattgaccatgtcatgtcgttgctgcgtctgtggtggataccgtatggc
gaaacagcggatcgcggggcatatgttcagtatccggttgacgatctgttggctattctg
gcgctggagagccaacgtcaccgctgtatggtgataggcgaagatctggggacggtgcca
gttgagattgtcggcaagctgcgcgatagcggggtctattcttataaagtgctgtggttt
gaaaatgaccttgagaaaaacttccgcgcgccaggcgcgtatccgcaacaatcgatggct
gtcgcctcgacgcacgatctccccacgctgcgcggctattgggaatgcggtgacctgacg
ttgggtaaagctctggggctttacccggatgaagtgattctgcgcgggctgtatgaggat
cgcgagcgggcgaaacaggggctattggacgcgctgcataaatatggctgtctgccaaaa
cgcgccgggcataaggcatcgttaatgtcgatgacgccaacgctaaatcgcggacttcag
cgctatatcgccgacagtaacagcggtctgttggggcttcagccggaggactggctggat
atggccgatccggttaacgtaccgggcaccagcgatcagtataaaaactggcgacggaag
ctcaccgccacgctggagcagatgtttgccgatgagggcgtaaacaagctgattaaggat
ttggataagcgccgaaaagcggccgcgaagaagaagtaa

DBGET integrated database retrieval system