KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A4150Help
Entry
SeSA_A4150        CDS       T00743                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
sew00860  Porphyrin and chlorophyll metabolism
sew01100  Metabolic pathways
sew01110  Biosynthesis of secondary metabolites
sew01120  Microbial metabolism in diverse environments
Module
sew_M00121  Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sew00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SeSA_A4150 (hemD)
Enzymes [BR:sew01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SeSA_A4150 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ACF88799
UniProt: A0A0N1QSC8
Position
complement(4023629..4024369)
Genome map
AA seq 246 aa AA seqDB search
MSILITRPSPAGEALVSRLRALGQVAWSFPLIEFVAGRELPTLADRLATLTENDLVFALS
QHAVAFAHAQLQRDGRNWPASPRYFAIGRTTALALHTVSGFDIRYPLDREISEALLQLPE
LQNIAGKRALILRGNGGRELLGETLTARGAEVSFCECYQRCAKHYDGAEEAMRWHTRGVT
TLVVTSGEMLQRLWSLTPQWYREHWLLRCRLLVVSERLAHLARELGWQDIKVADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtattctgatcacccgcccctctcccgcaggggaagcgttagtgagccgtctgcgc
gcactggggcaggtggcctggagttttccactgattgaatttgtcgccggtcgggagcta
cccaccctggccgaccgcctggcgactctgacggaaaacgatctggtttttgccctttca
cagcacgccgtcgcctttgctcacgcccagctccagcgggatggtcgaaactggcctgcg
tcgccgcgctatttcgcgattggccgcaccacggcgctcgcccttcataccgttagcggg
ttcgatattcgttatccattggatcgggaaatcagcgaagccttgctacaattacctgaa
ttacaaaatattgcgggcaaacgcgcgctgattttgcgtggcaatggcggccgcgaactg
ctgggcgaaaccctgacagctcgcggagccgaagtcagtttttgtgaatgttatcaacga
tgtgcgaaacattacgatggcgcggaagaagcgatgcgctggcatactcgcggcgtaaca
acacttgttgttaccagcggcgagatgttgcaacggctctggtcgctgactccccagtgg
tatcgtgagcactggttactacgctgtcggctattggtcgtcagtgagcgtctggcgcac
ctcgcccgggaactgggctggcaagatattaaggtcgctgataacgccgacaacgatgcg
ctgttgcgcgcattacaataa

DBGET integrated database retrieval system