KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A4297Help
Entry
SeSA_A4297        CDS       T00743                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
sew00010  Glycolysis / Gluconeogenesis
sew00051  Fructose and mannose metabolism
sew00562  Inositol phosphate metabolism
sew01100  Metabolic pathways
sew01110  Biosynthesis of secondary metabolites
sew01120  Microbial metabolism in diverse environments
sew01130  Biosynthesis of antibiotics
sew01200  Carbon metabolism
sew01230  Biosynthesis of amino acids
Module
sew_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sew_M00002  Glycolysis, core module involving three-carbon compounds
sew_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sew00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeSA_A4297 (tpiA)
   00051 Fructose and mannose metabolism
    SeSA_A4297 (tpiA)
   00562 Inositol phosphate metabolism
    SeSA_A4297 (tpiA)
Enzymes [BR:sew01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SeSA_A4297 (tpiA)
Exosome [BR:sew04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SeSA_A4297 (tpiA)
  Exosomal proteins of bladder cancer cells
   SeSA_A4297 (tpiA)
  Exosomal proteins of melanoma cells
   SeSA_A4297 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF3254
Motif
Other DBs
NCBI-ProteinID: ACF89293
UniProt: B4TPU2
Position
complement(4167313..4168080)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRKELTGVAGCDVAIAPPEMYIDLAKRAAAGSHIM
LGAQNVDLNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gaactggtggctaacctgcgtaaagaactgacgggcgtagcaggctgcgacgtggcaatc
gctccgccggaaatgtatatcgatctggcgaaacgcgctgctgccggcagccacatcatg
ctgggcgcgcagaacgttgatctgaatctgtctggcgcattcaccggtgaaacttcggct
gaaatgctgaaggatatcggcgcgcagtacattattatcggccactccgagcgtcgtact
tatcacaaagaatctgacgagctgatcgccaaaaaattcgccgtactgaaagaacaaggt
ctgacgccggtactgtgcatcggtgaaaccgaagcggaaaacgaagcgggcaaaacagaa
gaagtatgcgcacgccagatcgacgcggtactgaaaacgcagggcgcggcagcctttgaa
ggcgcggttatcgcttatgaacccgtatgggcgatcggtaccggtaaatctgcaactcct
gcgcaggcgcaggcggttcacaaattcatccgtgaccacattgctaaagctgacgcgaaa
atcgctgaacaggtcattatccagtacggcggttctgttaatgcctccaacgcagccgaa
ctgttcgcgcagccggacatcgacggcgcgctggttggcggtgcttctctgaaagctgac
gctttcgcggtgatcgtgaaagcagcagaagctgctaaacaggcttaa

DBGET integrated database retrieval system