KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A4302Help
Entry
SeSA_A4302        CDS       T00743                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sew00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4171393..4172901)
Genome map
AA seq 502 aa AA seqDB search
MTEKKYIVALDQGTTSSRAVVMDHDANIVSVSQREFEQIYPKPGWVEHDPMEIWASQSST
LVEVLAKADISSDQIAAIGITNQRETAIVWERETGKPIYNAIVWQCRRTADICEQLKRDG
LEDYIRDNTGLVVDPYFSGTKVKWILDHVEGSRERAKRGELLFGTVDTWLIWKMTQGRVH
VTDYTNASRTMLFNIHDLDWDDKMLDVLDIPRAMLPQVRKSSEVYGQTNIGGKGGTRIPI
AGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPSGEVN
YALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQSDILGTRVERPEVREVTALGAAYLAGLAVGYWQNLDELQEKAVIEREFRPGIETTER
NYRYSGWKKAVKRAMAWEEHDK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaaaaatatatcgttgcgctcgaccagggtaccaccagctcccgcgcggtc
gttatggatcatgacgcgaatatcgtcagcgtatcacagcgtgaatttgagcaaatttat
cctaagccaggctgggtagaacacgacccgatggaaatttgggcgtcccaaagctcaacg
ctggtagaagtgctggctaaggccgatatcagttccgatcagattgccgctatcggtatc
accaaccaacgtgaaaccgcgatcgtctgggaacgtgaaaccggcaaaccgatatacaac
gctattgtctggcagtgccgtcgtaccgccgatatttgcgaacagcttaaacgcgacggc
ctggaagattacatccgcgacaataccggtctggtcgtcgacccgtacttctctggcact
aaagtgaaatggatccttgaccatgtggaaggttcgcgcgaacgcgcgaagcgtggcgag
ctgctgttcggtacggtggatacctggcttatctggaagatgacgcagggccgcgtccac
gttacggattacaccaacgcctcacgaaccatgctgttcaacatccatgatttggactgg
gacgataagatgctggacgtgctggatatcccacgcgcgatgctgccccaggtacgtaag
tcctccgaagtctacggccagaccaatattggcggtaaaggcggtacacgtattcctatc
gccgggattgccggggatcagcaggccgcgctattcggccaactgtgcgtaaaggaagga
atggcaaagaacacctacggcaccggctgctttatgctgatgaacaccggcgagaaagcg
gtaaaatcggaaaacggcctgctgaccaccatcgcctgcggcccaagcggcgaagtcaac
tatgcgctggaaggcgcggtgtttatggcgggagcgtccattcaatggctgcgtgatgaa
atgaagctcatcagcgacgcgttcgactccgaatatttcgccacgaaagtgaaagatacc
aacggtgtctacgtggttccggccttcaccggtctgggcgcgccgtactgggatccgtat
gcccgcggtgccatttttggcctgacccgcggcgtgaactctaatcacattatccgcgcg
acgctcgaatccatcgcttaccagacccgcgacgtactggaagcgatgcaggccgactcc
ggtatccgcctgcacgctctgcgtgtggacggcggcgcagtggccaacaacttcctgatg
cagttccagtcagatattctcggcacgcgggtggaacgcccggaagtgcgcgaagtgacc
gcgctgggcgccgcctatctggctggtctggccgtcggttactggcagaacctggacgag
ctgcaggaaaaagccgtcattgaacgagaattccgccccggcattgaaaccaccgagcgt
aactaccgttacagcggctggaagaaagcggttaaacgcgcaatggcgtgggaagagcac
gacaagtaa

DBGET integrated database retrieval system