KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A4309Help
Entry
SeSA_A4309        CDS       T00743                                 

Gene name
ftsN
Definition
cell division protein FtsN
Orthology
K03591  
cell division protein FtsN
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4178164..4179168)
Genome map
AA seq 334 aa AA seqDB search
MAQRDYVRRGQPAPSRRKKSTSRNSRKKQSNMPAVSPAMVAIAAAVLVTFIGGLYFITHH
KKEESETLQNQKVTGNGLPPKPEERWRYIKELESRQPGVRTPTEPSAGGEVMNPNQLTSE
QRQLLEQMQADMRQQPTQLNEVPWNEQTPEQRQQTLQRQRQAQQQQQQQQQQQQQQWAQT
QPVQQPRTQPRVNEQPQTRTVQSAPAQPARQSQPPKQTASQQPYQDLLQTPAHTSAAAPK
AAPITRAPEAPKATAEKKDERRWMVQCGSFKGAEQAESVRAQLAFEGFDSKITTNNGWNR
VVIGPVKGKENADSTINRLKMAGHTNCIRLATGG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtggcacaacgagattatgtacgtcgcggccaaccggctccttcgcggcgcaaaaagagc
acctcacggaactcacggaagaagcaaagcaacatgcctgccgtctcgccggcaatggtc
gcgattgcggcagccgtccttgtgacctttatcggcggtctgtacttcattactcaccat
aagaaagaagagtccgaaacgctacaaaaccagaaagtcaccggcaatgggcttccgcca
aaaccggaagagcgctggcgttacatcaaagagctggaaagtcgccagccgggcgtgcgc
acgccaacggaaccgtccgccggcggcgaagtcatgaatccgaatcagctcaccagcgag
cagcgtcaactcctggagcagatgcaggcggatatgcgtcagcagccgacgcaacttaac
gaagtgccgtggaacgagcagacgccagaacaacgccagcaaacgctacagcgccagcgt
caggcgcagcagcagcagcagcagcagcagcagcagcagcagcagcagtgggctcaaacg
cagcctgttcagcaaccacgtacgcagccgcgggtaaacgagcagccacaaacacgcacg
gtacagtccgccccggcgcaacccgcgcgccaaagtcagccgccgaagcagacggcctcg
cagcaaccttatcaggatttgctgcaaacgccggcgcataccagcgcggcagcgccgaaa
gccgcaccaattacgcgcgcgcctgaagcgccgaaggcgacagcagagaaaaaagatgag
cgtcgctggatggtgcaatgtggttcattcaaaggcgccgagcaggcagaaagcgtccgc
gctcagctggcgtttgaaggctttgactccaaaattaccaccaataacggctggaatcgc
gtggttatcgggccggtgaaaggtaaagaaaatgccgacagcaccattaaccgtctgaag
atggcgggccatacaaactgcattcgactcgccaccgggggttga

DBGET integrated database retrieval system