KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A4309Help
Entry
SeSA_A4309        CDS       T00743                                 

Gene name
ftsN
Definition
cell division protein FtsN
Orthology
K03591  
cell division protein FtsN
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4178164..4179168)
Genome map
AA seq 334 aa AA seqDB search
MAQRDYVRRGQPAPSRRKKSTSRNSRKKQSNMPAVSPAMVAIAAAVLVTFIGGLYFITHH
KKEESETLQNQKVTGNGLPPKPEERWRYIKELESRQPGVRTPTEPSAGGEVMNPNQLTSE
QRQLLEQMQADMRQQPTQLNEVPWNEQTPEQRQQTLQRQRQAQQQQQQQQQQQQQQWAQT
QPVQQPRTQPRVNEQPQTRTVQSAPAQPARQSQPPKQTASQQPYQDLLQTPAHTSAAAPK
AAPITRAPEAPKATAEKKDERRWMVQCGSFKGAEQAESVRAQLAFEGFDSKITTNNGWNR
VVIGPVKGKENADSTINRLKMAGHTNCIRLATGG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtggcacaacgagattatgtacgtcgcggccaaccggctccttcgcggcgcaaaaagagc
acctcacggaactcacggaagaagcaaagcaacatgcctgccgtctcgccggcaatggtc
gcgattgcggcagccgtccttgtgacctttatcggcggtctgtacttcattactcaccat
aagaaagaagagtccgaaacgctacaaaaccagaaagtcaccggcaatgggcttccgcca
aaaccggaagagcgctggcgttacatcaaagagctggaaagtcgccagccgggcgtgcgc
acgccaacggaaccgtccgccggcggcgaagtcatgaatccgaatcagctcaccagcgag
cagcgtcaactcctggagcagatgcaggcggatatgcgtcagcagccgacgcaacttaac
gaagtgccgtggaacgagcagacgccagaacaacgccagcaaacgctacagcgccagcgt
caggcgcagcagcagcagcagcagcagcagcagcagcagcagcagcagtgggctcaaacg
cagcctgttcagcaaccacgtacgcagccgcgggtaaacgagcagccacaaacacgcacg
gtacagtccgccccggcgcaacccgcgcgccaaagtcagccgccgaagcagacggcctcg
cagcaaccttatcaggatttgctgcaaacgccggcgcataccagcgcggcagcgccgaaa
gccgcaccaattacgcgcgcgcctgaagcgccgaaggcgacagcagagaaaaaagatgag
cgtcgctggatggtgcaatgtggttcattcaaaggcgccgagcaggcagaaagcgtccgc
gctcagctggcgtttgaaggctttgactccaaaattaccaccaataacggctggaatcgc
gtggttatcgggccggtgaaaggtaaagaaaatgccgacagcaccattaaccgtctgaag
atggcgggccatacaaactgcattcgactcgccaccgggggttga

DBGET integrated database retrieval system