KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A4394Help
Entry
SeSA_A4394        CDS       T00743                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sew00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SeSA_A4394 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SeSA_A4394 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    SeSA_A4394 (aceB)
Enzymes [BR:sew01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SeSA_A4394 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4268008..4269612
Genome map
AA seq 534 aa AA seqDB search
MMNPQATTTDELTFTRPQGELEKQVLTAEAVEFLTELVTRFTPKRNKLLAARIQQQQDID
NGKLPDFISETTSIRESNWQIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADFE
DSLAPDWNKVMDGQINLRDAVNGTISYTNEAGKIYQLKPDPAVLICRVRGLHLPEKHVTW
RGEAIPGSLFDFALYFFHNYKALLAKGSGPYFYLPKTQAWQEAAWWSEVFSYAEDRFNLP
RGTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNYPDRVLPDRQ
VVTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDVERNNQVLAKVKADKALEANN
GHDGTWIAHPGLADTAMAVFNEVLGEHKNQLFITRDEDAPITAEQLLEPCEGERTEAGMR
ANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKTLSNGKPVTKTLF
REMLAEEMRVIQDELGEHRYSSGRFDDAARLMEQITTSDDLIDFLTLPGYRLLA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatccacaggcaaccacaactgatgaattaacctttaccaggccgcaaggcgag
ctggaaaagcaagtcctgaccgctgaggcagtcgagtttttgacggagttagttacccgt
tttacgccaaaacgcaataaactcctggctgcacgtatccagcaacagcaggatattgat
aacggtaagttgcctgattttatttcggaaaccacttccattagagaaagtaattggcag
attcgtggtattccggcggatttacaggatcgccgagtagaaattaccgggccggttgaa
cgtaaaatggtgattaatgccctgaacgcaaacgtgaaagtgtttatggcggattttgaa
gactcgctggcgccggactggaataaagttatggatggtcaaatcaacctgcgtgatgcg
gtgaacggcaccattagctataccaacgaagccggaaaaatctatcagctcaagcccgat
ccggccgtattgatttgtcgtgtacgtggtctacatctgccagaaaaacatgttacctgg
cggggggaagccattcccggcagcctgtttgattttgctctgtactttttccacaactat
aaagcgctgctcgctaaaggtagcggcccgtatttttacctgccgaaaacgcaagcctgg
caggaagcagcctggtggagtgaagttttcagctacgccgaagaccgcttcaatctaccg
cgcggtacgatcaaagcgaccctgttgattgaaacgctgcctgctgttttccagatggat
gagattcttcatgcgctgcgtgatcatatcgtcggtctcaactgtggtcgctgggattat
attttcagctatatcaaaacgttgaaaaattacccggatcgcgtcttgccggacaggcag
gtggtaacgatggacaaaccgtttctgagcgcctactcgcgcctgctaatcaaaacctgt
cacaagcgcggcgcgttcgcgatgggcggtatggcggcgtttatcccgagcaaagacgtt
gaacgcaacaatcaggtccttgccaaagtgaaagcggataaagcgctggaagcgaacaac
ggccacgacggcacgtggattgcgcatcccgggttggcggataccgcaatggccgtcttt
aacgaggtactgggcgagcacaaaaatcagctgttcattacccgtgatgaagatgcgccg
attaccgctgaacagttactggagccatgtgaaggcgaacgcacagaagcgggaatgcgc
gccaatattcgcgtggcagtgcagtacattgaagcgtggatctccggcaatggctgtgta
ccgatttacggtctgatggaggatgccgcgacggcggaaatctcacgaacctctatctgg
cagtggattcaccatgagaaaacactgagcaatggaaaacccgtaacgaaaacgcttttc
cgcgaaatgttggcggaagagatgcgggtaatccaggacgaactgggcgagcaccgctac
agcagcgggcgcttcgacgatgccgcacgtctgatggagcaaatcaccacctcagatgac
ttaatcgacttcctcaccctgccgggctatcgcttactggcttaa

DBGET integrated database retrieval system