KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A4672Help
Entry
SeSA_A4672        CDS       T00743                                 

Gene name
cysQ
Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sew00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SeSA_A4672 (cysQ)
Enzymes [BR:sew01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SeSA_A4672 (cysQ)
Transfer RNA biogenesis [BR:sew03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    SeSA_A4672 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4540717..4541457
Genome map
AA seq 246 aa AA seqDB search
MLEQVCQLARNAGDAIMQVYDGAKPMEYARKQDDSPVTAADIAAHTVILEGLRTLTPDIP
VLSEEDPPAWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIEQGKPVLGVVYAPVL
KVMYYAAEGKAWKEECGVRKQIQVRDARPPLVVISRSHTDDELTEYLQQLGEHQTTSIGS
SLKFCLVAEGQAQLYPRFGPTSVWDTAAGHAIAVAAGAHVHDWQGKTLDYTPRESFLNPG
FRVTIY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacaagtatgccagcttgcacggaacgcgggcgatgccattatgcaggtttat
gatggagccaaaccgatggagtacgcccgcaagcaggacgattctccagtcactgcggcg
gatatcgccgcacataccgtgattctcgaagggttacgcacgctcacgccggatattccg
gtgctttcagaagaagatccgcctgcctgggaagtgcgccagcactggcagcgctactgg
ctggtcgatccgctcgacggcaccaaagagttcatcaagcgcaatggcgaattcacggtc
aatatcgcgctgattgagcagggcaaaccggtgttgggcgtggtctatgcgccggtgctg
aaagtgatgtactacgcggcggaaggtaaggcctggaaagaggagtgcggagtgcgtaag
cagattcaggtccgggatgcccgcccgccgctggtggtgattagccgttcgcatacggat
gatgaactcaccgaatatctccaacagcttggcgaacatcagacaacttctattggttcc
tcgctgaaattctgtcttgtggcggaaggccaggcgcagctttaccccagatttgggccg
accagcgtctgggacactgccgcaggtcatgccattgccgttgcagccggggcgcacgtt
cacgactggcagggaaaaacgctggactatacccctcgtgaatcgttccttaaccccggc
ttccgggtgactatttactga

DBGET integrated database retrieval system