KEGG   Salmonella enterica subsp. enterica serovar Schwarzengrund: SeSA_A4732Help
Entry
SeSA_A4732        CDS       T00743                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
sew  Salmonella enterica subsp. enterica serovar Schwarzengrund
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sew00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SeSA_A4732 (holC)
   00240 Pyrimidine metabolism
    SeSA_A4732 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SeSA_A4732 (holC)
   03430 Mismatch repair
    SeSA_A4732 (holC)
   03440 Homologous recombination
    SeSA_A4732 (holC)
Enzymes [BR:sew01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SeSA_A4732 (holC)
DNA replication proteins [BR:sew03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SeSA_A4732 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4595898..4596380)
Genome map
AA seq 160 aa AA seqDB search
MATHLNPPQEAPYMKNATFYLLDNDTTVNGLSAVEQLVCEIAAERWRAGKRVLIACEDEK
QAIRLDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRNSSPRDILISLRTSFADFA
TAFTEVVDFVPYEETLKQLARERYKAYRVAGFNLNTATWK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcatttaaatccaccacaagaagccccatatatgaagaatgcgacgttctat
cttctggataatgacactaccgtcaatggtttaagcgccgttgaacaactggtgtgtgaa
attgccgcagaacgttggcgcgccggcaagcgcgtgctgatcgcctgcgaagatgagaag
caggccattcggttggatgaagcgctgtgggcaagaccggcggaaagttttgtcccgcac
aatctggcaggcgaaggcccacgcggcggcgcgccggttgaaattgcctggccgcaaaaa
cgcaacagcagcccgcgcgatattttaatcagcctgcgtacaagctttgcagattttgcc
accgctttcacagaagtggtagacttcgtcccttacgaagaaactttgaaacaactggcg
cgcgaacgctacaaagcctaccgcgtggctggttttaacctgaatacggcaacctggaaa
taa

DBGET integrated database retrieval system