KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_10300Help
Entry
STBHUCCB_10300    CDS       T01741                                 

Definition
chemotaxis response regulator protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sex00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    STBHUCCB_10300
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    STBHUCCB_10300
Enzymes [BR:sex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     STBHUCCB_10300
Two-component system [BR:sex02022]
 CheA family
  CheA-CheYBV
   STBHUCCB_10300
Bacterial motility proteins [BR:sex02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    STBHUCCB_10300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
1046753..1047802
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYS
EMIAEKVRTAARARIAAHKPMAAPTTLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL
SSPAVIITQHMPPGFTRSFAERLNKLCQISVKEAEDGERVLPGHAYIAPGDKHMELARSG
ANYQIKIHDGPPVNRHRPSVDVLFHSVAKHAGRNAVGVILTGMGNDGAAGMLAMYQAGAW
TIAQNEASCVVFGMPREAINMGGVSEVVDLSQVSQQMLAKISAGQAIRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagggtattgtcagttgatgattccgcgctaatgcgccaaatcatgact
gaaattattaatagccatagcgatatggagatggtagcgactgcgccggacccgttggtc
gccagggatctcatcaaaaaatttaatccggacgtattgaccttggacgttgagatgccg
cgtatggacggcctcgattttctggaaaaactgatgcgcctgcgaccgatgccggtggtg
atggtctcttcgctgaccgggaaaggttccgaagtgacgctacgggcgctggagttgggg
gccatcgattttgtcaccaaaccgcagcttggcattcgtgaaggtatgctggcgtatagc
gagatgattgccgaaaaagtgcgtaccgccgcgcgggcccgcatcgccgcacataaaccg
atggcggccccgacaaccttaaaagccggtccgctgctcagttcggaaaaactgattgct
atcggcgcttcaacgggcggtactgaagctatccgacatgtgctgcaaccgctgccgctt
tccagtccggcagtgattattacgcagcatatgccgcctggctttacccgctcgtttgcc
gagcgcctgaataaactctgtcaaatcagcgtgaaggaggcggaggacggcgaacgcgta
ttgccaggtcatgcctacattgcgcccggcgacaagcatatggagctggcgcgtagcggg
gcgaattatcaaatcaaaattcatgatggcccgccggtaaaccggcatcggccttccgtg
gatgtgctgtttcattcggtggcgaaacacgcggggcgcaacgccgtaggcgtcattctt
acggggatgggcaacgatggcgccgctggaatgttagcgatgtaccaggctggcgcctgg
accattgcgcaaaacgaagcaagttgtgtggtgttcggcatgccgcgcgaggccatcaat
atgggtggcgtaagcgaagtggtcgatcttagccaggtaagccagcagatgctggcgaaa
atcagtgccggacaggcgatacgtatttga

DBGET integrated database retrieval system