KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_12950Help
Entry
STBHUCCB_12950    CDS       T01741                                 

Definition
(GenBank) 6-phosphofructokinase isozyme 2
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
sex00010  Glycolysis / Gluconeogenesis
sex00030  Pentose phosphate pathway
sex00051  Fructose and mannose metabolism
sex00052  Galactose metabolism
sex00680  Methane metabolism
sex01100  Metabolic pathways
sex01110  Biosynthesis of secondary metabolites
sex01120  Microbial metabolism in diverse environments
sex01130  Biosynthesis of antibiotics
sex01200  Carbon metabolism
sex01230  Biosynthesis of amino acids
Module
sex_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STBHUCCB_12950
   00030 Pentose phosphate pathway
    STBHUCCB_12950
   00051 Fructose and mannose metabolism
    STBHUCCB_12950
   00052 Galactose metabolism
    STBHUCCB_12950
  Energy metabolism
   00680 Methane metabolism
    STBHUCCB_12950
Enzymes [BR:sex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     STBHUCCB_12950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617
Motif
Other DBs
NCBI-ProteinID: AEZ45006
Position
complement(1272505..1273437)
Genome map
AA seq 310 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCSAPVFEPGGGGINVARAIAHLGGTATAIFP
AGGATGEHLVALLADENVPVSTVDAKDWTRQNLHVHVESSGEQYRFVMPGATLDDDEFRQ
LEEQVLEIESGAILVISGSLPPGVKVEKLTQLISAAQKQGIRCIIDSSGDALTAALALGD
IELVKPNLKELSALVNRDLTQPDDVRKAAQELVQSGKARRVVVSLGPQGALGIDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAQDASLEEMVRFGVAAGSAATLNQGTRLCSHDDT
QKIYAYLSAQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacgcttgcgccctctctcgatagcgcaacaatcacgccg
caaatttatcccgaaggtaaactgcggtgctccgcgccggtattcgaacccggcggcggg
ggtattaatgtcgctcgcgccattgcgcatcttggcggcaccgcgaccgcaattttcccg
gctggcggcgctaccggcgaacatctggtcgcactactggctgacgaaaatgtccccgtg
tctaccgtcgatgcgaaggactggacgcgtcagaacctgcacgtccacgtcgagtccagc
ggcgaacaatatcgttttgttatgcccggcgccacgctggacgatgacgaatttcgccag
cttgaagaacaggtactggaaattgaatccggggcaattctggttatcagcggcagcctt
ccgcccggcgttaaggtcgagaaactcacgcaactgatttccgccgcgcagaagcaaggc
attcgctgcattattgatagctctggcgacgcgctcaccgctgcgttggcgcttggcgat
atcgaactggtgaaacctaacctgaaagaattgagcgcgttagtcaatcgcgatctgacg
cagcctgatgatgtgcgtaaagcggcccaggaattagtgcaaagtggcaaggctcgccgg
gtagtggtctctctggggccgcaaggggcgctgggcatagacagtgagaattgcatccag
gttgttcctcccccggtgaaaagtcaaagtactgtcggcgcaggcgacagtatggtgggc
gcgatgacgttaaaactggcgcaagacgcgtcgctggaagagatggtgcgcttcggtgtg
gcggcaggcagcgccgctacgctcaatcaaggtacgcgtctgtgttctcatgacgatacc
caaaaaatatacgcctatctttccgcgcaataa

DBGET integrated database retrieval system