KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_20410Help
Entry
STBHUCCB_20410    CDS       T01741                                 

Definition
nicotinate phosphoribosyltransferase
Orthology
K00763  
nicotinate phosphoribosyltransferase [EC:6.3.4.21]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:sex00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1969374..1970576
Genome map
AA seq 400 aa AA seqDB search
MTQFASPVLHSLLDTDAYKLHMQQAVFHHYYDVQVAAEFRCRGDDLLGIYADAIREQVDA
MQHLRLQEDEFQWLSGLPFFKPDYLNWLREFRYNPAQVCVTNDNGKLNIRLTGSWREVIM
WEVPLLAVISELVHHYRSPNAGVDQALDALESKLVDFTALTANLDMSRFHLMDFGTRRRF
SREVQQAIVKRLQQESWFVGTSNYDLARRLALTPMGTQAHEWFQAHQQINPDLATSQRAA
LAAWLNEYPDQLGIALTDCITMDAFLRDFGIEFASRYQGLRHDSGDPVAWGEKAIAHYEK
LGIDPLTKTLVFSDNLDLPKAVELYRHFASRVQLSFGIGTRLTCDIPQVKPLNIVIKLVE
CNGKPVAKLSDSPGKTICHDKAFVRALRKAFDLPQVRKAS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacacaattcgcttctcctgttctgcactcgttgctggatacagatgcttataagttg
catatgcagcaagccgtttttcaccactactatgatgtgcaggtagcggctgagtttcgt
tgccgtggcgacgacctgctgggtatttatgccgatgctattcgcgagcaggtggacgcg
atgcagcacctgcgcctccaggaggacgagttccagtggctctccggcctgccctttttt
aaaccggattatctgaactggttacgcgagtttcgctataacccagctcaagtctgtgtc
accaacgataacggcaagctgaatattcgcttaaccggctcgtggcgtgaagtcattatg
tgggaagtgccgctgctggccgtgatcagtgagctggttcatcactaccgctcgccaaac
gcgggcgttgatcaggcgctcgacgcgctggaaagtaagctggttgatttcactgcgtta
accgccaatctcgatatgtcccgcttccacctgatggacttcggcacccgccgccgtttc
tctcgtgaagtgcagcaggcgatagttaaacgtctccagcaggagtcatggttcgtcggc
accagcaactatgatctcgcgcgtcgcctggcgctgacgccgatgggcactcaggcgcac
gaatggttccaggcgcatcaacaaatcaatccggacctggcgaccagtcagcgtgccgcg
ttggccgcctggcttaacgaatatccggaccagcttggtatcgcattgacagattgcatt
acaatggatgcgtttttacgcgatttcggcattgaattcgccagccgttatcaggggtta
cgccacgactcaggagaccctgtcgcatggggcgaaaaggcgattgcccattatgaaaag
ctggggattgatccgctgacaaaaacgctggtcttttcagataaccttgatctgccaaag
gcggtcgagctctatcgccatttcgcctctcgcgtgcagttaagcttcggcatcggtacc
cgactgacctgcgatatccctcaggtaaaaccgctcaatatcgtgattaagctcgtggaa
tgtaacggaaagccggtggctaaactttccgacagccccggtaaaacgatctgtcatgat
aaagcgtttgtgcgcgcgctgcgtaaagcgttcgatctcccgcaggtgcgtaaagcaagt
taa

DBGET integrated database retrieval system