KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_2110Help
Entry
STBHUCCB_2110     CDS       T01741                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sex00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(217806..218285)
Genome map
AA seq 159 aa AA seqDB search
MTIAYIALGSNLASPLEQVNAALKAIADIPDSRIVAVSSFYRTPPLGPQDQPDYLNAAVA
LDTALAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGDEVINTDRLTVPHYDMK
NRGFMLWPLFEIAPELVFPDDKGLLIELMSQMSPCPDRW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgcgtatatcgcgcttggcagtaatctggcctctccgctggagcaggtcaat
gccgccctgaaggctatcgccgacattcccgatagccgtatcgtcgcggtttcttcgttt
taccgcacgccgccgcttggcccacaggatcagcccgattacctgaacgctgcggtggcg
ctggataccgctctcgcccccgaagaattgcttaaccatacccagcgcattgagctgcaa
cagggccgggtgcgcaaggccgaacgctgggggccgcgcacgctggatctcgacattatg
ctgtttggcgatgaagtcattaacaccgaccgtctgaccgtgccgcactacgacatgaaa
aaccgcggttttatgctgtggccgttattcgaaatcgctccggagctggtgtttcccgac
gataaaggtctgctgatcgagctgatgtcccaaatgtctccctgtcccgatcgttggtaa

DBGET integrated database retrieval system