KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_22410Help
Entry
STBHUCCB_22410    CDS       T01741                                 

Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STBHUCCB_22410
   01230 Biosynthesis of amino acids
    STBHUCCB_22410
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STBHUCCB_22410
  Energy metabolism
   00680 Methane metabolism
    STBHUCCB_22410
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STBHUCCB_22410
Enzymes [BR:sex01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     STBHUCCB_22410
Exosome [BR:sex04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   STBHUCCB_22410
  Exosomal proteins of melanoma cells
   STBHUCCB_22410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2176150..2176902
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNDTILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtacgtcacggtgaaagtcaatggaacaaagagaac
cgtttcaccggctggtatgatgttgacctgtctgaaaaaggcgtaagcgaagcaaaagca
gcgggtaaactgctaaaagaagaaggtttcagctttgattttgcctacacttccgtactg
aaacgcgctatccatacgctgtggaacgtactggatgaactggatcaggcgtggctgccg
gtggaaaaatcctggaaactcaatgaacgtcactatggcgcgttgcaagggctgaataaa
gcggaaacggcagaaaaatatggtgacgagcaggttaagcagtggcgccgcggttttgcc
gtgacgccgccggaactgaccaaagatgatgagcgttatccgggtcacgatccacgttat
gccaaactgagcgagaaagagctgccgttgaccgaaagtctggcgctgaccatcgaccgc
gttattccttactggaacgacaccatcctgccgcgtatgaagagcggtgagcgcgtgatc
atcgccgctcacggtaactcattgcgtgcgctggtgaaatacctggataacatgagtgaa
gatgagattcttgagttaaacatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaagccgatcaaacattactatctgggtaacgctgacgaaatcgccgcgaaagcg
gctgccgtggcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system