KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_22700Help
Entry
STBHUCCB_22700    CDS       T01741                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
sex00020  Citrate cycle (TCA cycle)
sex00190  Oxidative phosphorylation
sex00650  Butanoate metabolism
sex01100  Metabolic pathways
sex01110  Biosynthesis of secondary metabolites
sex01120  Microbial metabolism in diverse environments
sex01130  Biosynthesis of antibiotics
sex01200  Carbon metabolism
Module
sex_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sex_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sex_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sex00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    STBHUCCB_22700
   00650 Butanoate metabolism
    STBHUCCB_22700
  Energy metabolism
   00190 Oxidative phosphorylation
    STBHUCCB_22700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AEZ45943
Position
complement(2204359..2204706)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTFEAWTGFFSSAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLAVRLILQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgacttcatcctggtccgt
gctaccgctatcgttctgacgttatacatcatctacatggtgggttttttcgccacgagc
ggcgaactgacctttgaagcctggaccggtttcttctcatcggccttcaccaaagtcttc
actctgctggcgcttttttccatcttaattcatgcctggatcggcatgtggcaggtgtta
accgactacgttaaaccactggcagtgcgtctgatactgcaactcgttattgttgttgcg
ctggtggtttacgtcatctatggatttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system