KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_23250Help
Entry
STBHUCCB_23250    CDS       T01741                                 

Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sex00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    STBHUCCB_23250
Enzymes [BR:sex01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     STBHUCCB_23250
Peptidases [BR:sex01002]
 Cysteine Peptidases
  Family C44
   STBHUCCB_23250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2261253..2262917
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVFDIKTDAAELRKKALELSRLMRHRGPDWSGIYACDNAILAHERLSIVDVNAGA
QPLYNAKKTHVLAVNGEIYNHQTLRAEYGDRYAFQTGSDCEVILALYQEKGPDFLDDLQG
MFAFALYDSEKDAYLIGRDHIGIIPLYMGYDEFGNFYVASEMKALTPVCRTIKEFPAGSY
LWSKDGEIRQYYQRDWFDYDAVKDNVTDKNALRQALEESVKSHLMSDVPYGVLLSGGLDS
SVISAITKKFAARRVEDQERSEAWWPQLHSFAVGLEGSPDLKAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLQALHMYDCTRANKAMSAWGVEARVPFLDKKFLDVAMRINPQD
KMCGNGKMEKHVLRECFESYLPASVAWRQKEQFSDGVGYSWIDTLKEVAAKQISDQQLET
ARFRFPYNTPSSKEAYLYREIFEELFPVPSAAECVPGGPSVACSSAKAIEWDEAFKTMDD
PSGRAVGVHQSAYQ
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctattttcggcgtattcgatatcaaaacagatgcagcggaactgcgtaaaaaa
gcccttgaattgtcacgcctgatgcgccatcgcggcccggactggtccggcatctacgct
tgcgataacgcgattctcgcacatgaacgcttgtcgattgttgatgttaacgccggcgcc
cagcccctgtataacgctaagaaaactcacgtgctggcggtgaacggtgaaatttataac
catcagacgttacgcgcggagtatggcgatcgttacgcgttccagactggctccgactgc
gaagttattctcgcgctatatcaggaaaaagggccggatttccttgacgatttacagggg
atgttcgccttcgccctgtatgacagcgaaaaagacgcttatctgattggtcgtgaccat
atcggtattattccgctctacatgggctatgacgaattcggcaacttctacgtagcgtca
gaaatgaaagcgctgactccggtctgccgcaccattaaagagttcccggcgggcagctac
ctgtggagcaaagacggcgaaattcgtcagtactatcagcgcgactggttcgattacgat
gcggtaaaagataacgtcaccgacaaaaacgcgctgcgtcaggcgctggaagaatccgtg
aaaagccacctgatgtccgacgtgccctacggcgtactgctctccggcggcctggactcg
tcggttatctcggcaatcaccaaaaaattcgccgcccgtcgcgtcgaagatcaggagcgc
tccgaagcctggtggccacagttgcactcttttgcggtaggtctggaaggttcgcctgac
ctgaaggcggcccaggaagtggctaaccacctcggcaccgtgcatcatgaaattcacttc
accgtccaggagggtctggatgcgattcgcgacgtgatttaccacattgaaacctatgac
gtaaccactatccgcgcctcaacgccaatgtatctgatgtcgcgtaagatcaaagcgatg
ggcatcaaaatggtgctctccggcgaaggttctgatgaggtgtttggcggctacctgtac
ttccataaagcgccgaacgccaaagagttacatgaagagacggtccgtaagctacaggcg
ctgcatatgtatgactgcacccgcgccaacaaagcgatgtccgcctggggcgtggaagcg
cgcgtaccgttcctggataaaaaattcctcgacgtggcgatgcgtatcaacccacaggat
aaaatgtgcggcaacggcaagatggaaaaacacgtgctgcgcgagtgcttcgagtcttat
ctgccagcaagcgtggcgtggcgtcagaaagagcagttctctgacggcgtaggctacagc
tggattgatacgctgaaagaggtggcggcgaaacagatttccgatcaacaactggaaaca
gcccgcttccgctttccatacaacacgccgtcgtctaaagaggcgtacttgtaccgggaa
atttttgaagaattgttcccggtgccgagcgccgcggaatgcgtacccggcggcccgtcc
gtggcctgttcttccgccaaagccattgagtgggatgaagcattcaaaacgatggatgac
ccgtcaggccgcgcggtcggcgtgcatcagtcggcgtaccagtaa

DBGET integrated database retrieval system