KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_30Help
Entry
STBHUCCB_30       CDS       T01741                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
sex00260  Glycine, serine and threonine metabolism
sex00750  Vitamin B6 metabolism
sex01100  Metabolic pathways
sex01110  Biosynthesis of secondary metabolites
sex01120  Microbial metabolism in diverse environments
sex01230  Biosynthesis of amino acids
Module
sex_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sex00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STBHUCCB_30
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    STBHUCCB_30
Enzymes [BR:sex01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     STBHUCCB_30
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AEZ43766
Position
3734..5020
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKQQGLFFPHDLPEFSLTEIDEMLNQDFVSRSAKILS
AFIGDEIPQQILEERVRAAFAFPAPVAQVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
ISGDKPVTILTATSGDTGAAVAHAFYGLENVRVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKTALGLNSANSINISRLLAQICYYFEAVAQLPQGARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNINDTVPRFLHDGKWAPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWRLTELGYAAVDDTTTQQTMRELKAKGYISEPHAAVAYRA
LRDQLNPGEYGLFLGTAHPAKFKESVESILGETLALPEALAERADLPLLSHHLPADFAAL
RKLMMTRQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctataatctgaaagaccataatgagcaggtcagctttgcgcaggccgtcacg
caagggctgggcaaacagcagggacttttttttccgcacgatctgccggagtttagcctg
acggaaattgatgagatgctcaaccaggactttgtcagccgtagcgcaaagatcctctcg
gcatttattggcgatgaaataccgcagcaaattctggaagagcgcgtccgcgcggcgttt
gctttcccggcgccggtagcgcaggtagaaagtgatgtcggctgcctggagctgttccat
ggtccgacgctggcctttaaagacttcggcgggcgttttatggcgcaaatgctgacgcat
atcagcggcgataaaccggtgacgattctgaccgcaacgtcaggcgataccggcgcggcg
gtggctcacgcgttctatggcctggaaaatgtgcgggtcgtcattctctacccgcgcggt
aaaatcagtccgttgcaggaaaaactgttctgtacgctgggcggcaacattgagaccgtg
gcgatcgacggcgatttcgacgcttgccaggcgctggtgaaacaggcatttgatgacgaa
gaactgaaaacggcgctggggttgaattcggctaattcgattaatatcagccgcctgctg
gcgcaaatttgctactactttgaagccgtggcgcaactgccgcagggggcgcgtaaccaa
ctggtgatctccgtacccagcggcaactttggcgatttgacggcaggactgctggcgaag
tcgttaggcctaccggtgaaacgctttatcgccgccaccaacattaacgatacggtgccg
cgttttctgcatgacgggaagtgggcgccaaaagcgacgcaggcgaccctgtcgaatgcg
atggatgtcagccagccgaataactggccgcgtgtggaggagctattccgccgtaaaatc
tggcgtctgactgagctgggctatgcggcggtggatgacactacgacacaacagacgatg
cgcgagctgaaagcgaaaggttatatctcggaacctcatgcggcggtagcgtatcgggca
ttacgcgaccagttaaaccctggcgagtatggcttgtttctcggaacggcgcatccggcg
aagtttaaagaaagcgtggagtccattctgggagaaacgctggcattgcctgaagcgctc
gccgaacgcgccgatctgccgttgctttcacatcatctgcctgcggattttgccgccctg
cgtaagctaatgatgacccgccagtaa

DBGET integrated database retrieval system