KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_30390Help
Entry
STBHUCCB_30390    CDS       T01741                                 

Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
sex00051  Fructose and mannose metabolism
sex01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sex00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    STBHUCCB_30390
Enzymes [BR:sex01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     STBHUCCB_30390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AEZ46684
Position
complement(2955736..2956383)
Genome map
AA seq 215 aa AA seqDB search
MERNRLARQIIDTCLEMTRLGLNQGTAGNVSVRYQGGMLITPTGIPYEKLTESHIVFIDA
DGQHEQGKLPSSEWRFHMAAYQTRPDANAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG
NSIPCAPYATFGTRELSDHVAVALKNRKATLLQHHGLIACEENLDKALWLAHEVEVLAQL
YLSTLAIVDPVPVLDDEAIAIVLEKFKTYGLRIEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaaatagactggctcggcagattattgatacctgtctggaaatgacgcggtta
gggttaaatcaggggacggcaggtaacgtgagcgtacgttatcagggcggaatgctgatt
acgccgacggggatcccctacgagaagctgacagagtcgcacattgtctttattgatgca
gacggtcagcatgagcagggcaagctgccttccagcgagtggcgttttcatatggcggca
taccagacgcgccctgacgccaatgccgtggtacataaccacgctgtccattgtacggca
gtctcgatcctgaatcgcccgattccggcgattcactacatgattgccgccgcggggggg
aactctattccctgcgcgccctacgccacttttggcacccgcgaactttctgaccatgtt
gccgtggcgcttaaaaatcgtaaagcgacgctgttacagcatcacgggcttatcgcttgt
gaagaaaatttagacaaagcgttgtggctggcgcatgaagtggaagtgctggcgcagctc
tatttaagtacgctggccattgtcgatccggtaccggtactggatgacgaggcgatcgct
atcgtactggagaaatttaaaacttacggattacgtattgaagagtga

DBGET integrated database retrieval system