KEGG   Salmonella enterica subsp. enterica serovar Typhi P-stx-12: STBHUCCB_30430Help
Entry
STBHUCCB_30430    CDS       T01741                                 

Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
sex  Salmonella enterica subsp. enterica serovar Typhi P-stx-12
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sex00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2958287..2960017
Genome map
AA seq 576 aa AA seqDB search
MKKISLPKIGIRPVIDGRRMGVRESLEEQTMNMAKATAALITEKIRHACGAQVECVIADT
CIAGMAESAACEEKFSSQNVGVTITVTPCWCYGSETIDMDPMRPKAIWGFNGTERPGAVY
LAAALAAHSQKGIPAFSIYGHDVQDADDTSIPADVEEKLLRFARAGLAVASMKGKSYLSV
GGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFRY
GEDQNASQYKRNEAQNRAVLKESLLMAMCIRDMMQGNKTLADKGLVEESLGYNAIAAGFQ
GQRHWTDQYPNGDTAEALLNSSFDWNGVREPFVVATENDSLNGVAMLFGHQLTGTAQIFA
DVRTYWSPEAVERVTGQALSALAEHGIIHLINSGSAALDGACKQRDSEGKPTMKPHWEIS
QQEADACLAATEWCPAIHEYFRGGGYSSRFLTEGGVPFTMTRVNIIKGLGPVLQIAEGWS
VELPKAMHDQLDARTNSTWPTTWFAPRLIGKGPFTDVYSVMANWGANHGVLTIGHVGADF
ITLAAMLRIPVCMHNVEEAKIYRPSAWAAHGMDIEG
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcagcttaccgaaaatcggtatccgcccggtgattgatggacgtcgtatg
ggcgtacgcgagtcgctcgaagagcaaaccatgaacatggcgaaagcgacggcggcgctc
atcaccgagaaaatccgccacgcctgtggggcacaggtggagtgcgtcattgcggatacc
tgtattgccggaatggcggaatccgccgcctgtgaagaaaaattcagtagccagaacgtg
ggcgtgaccattaccgttacgccgtgctggtgctatggcagcgaaaccattgatatggac
ccgatgcgtccgaaagccatctggggctttaacggcacagagcgtcccggggcggtttac
cttgccgcggcgctggcggcgcacagccaaaaaggcattccggcgttctccatttatggc
catgacgtgcaggatgccgacgatacctccattcctgccgacgtcgaagaaaaactgctg
cgttttgcgcgggcagggttagcggtagccagcatgaaaggcaaaagctacctctccgtc
ggcggcgtgtcgatggggatcgcgggttccattgtcgatcataacttctttgaatcctgg
ctgggcatgaaggtgcaagcggtagatatgaccgaactgcgccgccgtatcgatcaaaaa
atttatgatgaggccgaactggagatggcgctggcgtgggcggataaaaacttccgctac
ggcgaagatcaaaacgcctcgcagtataagcgcaatgaagcccagaaccgcgcggtgcta
aaagagagcctgctgatggcgatgtgtattcgcgacatgatgcagggcaacaagacgctg
gcggacaaagggttagttgaagaatcgctgggctacaacgccattgccgccggcttccag
ggccagcgccactggaccgatcaatacccgaacggcgataccgccgaagcgctgctcaat
agctcttttgactggaacggcgtacgcgaaccgtttgtcgtcgccaccgaaaatgacagt
ctgaacggagtagcgatgctgtttggccatcaactcaccggtaccgcgcagatattcgcc
gacgtgcgaacttactggtcgccggaagccgtagaacgcgtcaccggccaggcgctcagc
gccctggcggaacacggcattattcacctgattaactccggttctgccgcgctggacggt
gcctgtaaacagcgcgacagcgaaggcaagccgaccatgaaaccgcactgggaaatcagc
caacaagaggcggatgcgtgtctggcggccactgaatggtgcccggcaattcacgaatac
ttccgcggcggcggctactcatcccgttttctgaccgaaggcggcgtgccattcaccatg
acccgcgtgaatatcatcaaaggcctgggaccagtactgcaaatcgccgaggggtggagc
gtcgaactgccgaaagcgatgcacgatcagcttgatgcccgcaccaactctacctggcct
accacctggtttgcgccgcgtcttatcggcaaaggtccgtttaccgatgtctattcggtg
atggcgaactggggcgctaaccacggcgtactcaccatcggtcatgtaggggcggacttt
attactctcgccgcgatgctgcgtatcccggtatgtatgcacaacgtggaggaggcgaag
atctaccgtccttccgcctgggcggctcacggtatggatatcgaaggctag

DBGET integrated database retrieval system